KEGG   Trypanosoma cruzi: 509051.30Help
Entry
509051.30         CDS       T01012                                 

Definition
(RefSeq) dTDP-glucose 4,6-dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00520  Amino sugar and nucleotide sugar metabolism
tcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    509051.30
Enzymes [BR:tcr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     509051.30
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD adh_short NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind NmrA NAD_binding_10 DUF43
Motif
Other DBs
NCBI-GeneID: 3536096
NCBI-ProteinID: XP_806161
GeneDB: Tc00.1047053509051.30
UniProt: Q4CVL0
AA seq 325 aa AA seqDB search
MPGENFGEVVLITGGSGFIGSHVVDRAMREGYTVVAVDNDYTGREQNIAHHIGKENFHFV
KHDVRHPYPEEVLRHKYNYIFHLASPASPVHYQADPIGTTLTCVNGTYHSLLLAQRDDCP
VLIASTSEVYGDPIQHPQTEEYWGNVNCTGVRSCYDEGKRCAESLCFDFHRKHGVKIRVA
RIFNTYGPRMCFNDGRIISNFLIQSLRGEDITVYGTGTQTRSFQYCDDLVEGFFRLIRHP
TEIGPVNLGNPDEYTVLDMAKKVRDFVPGTKSNICFLSPCEDDPKQRCPDISKARRVLGW
TPVVPLSEGLRRTAEDFAARVSRGE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcctggggagaatttcggcgaagtggtgctgatcacagggggctctggatttatcggc
agtcatgttgtggaccgtgcaatgcgtgagggatacaccgttgttgctgtggataatgat
tacactggcagggaacagaacattgcccatcacatcggcaaggaaaattttcactttgtg
aagcatgacgtgcgccatccctaccctgaggaggttttgaggcataagtataactacatc
ttccaccttgccagccccgcgtctcccgtgcactatcaggccgatccaattggtacaacg
ctgacatgcgtaaacgggacgtaccactcattgcttcttgcccagcgggatgactgtccg
gtgctcattgcgtccacctcggaggtgtacggtgacccaatccagcacccacagacggag
gaatattggggtaatgtgaactgcactggagtgagaagctgctatgatgagggtaaacgg
tgtgccgaatcactatgctttgattttcacaggaagcatggagtcaaaattcgtgtggct
cgcatttttaatacgtatggtcctcgcatgtgctttaatgatggccgcattattagcaac
tttctcattcagtccctcaggggtgaagatattactgtgtacgggacaggcacgcaaacc
cgctcgtttcaatattgcgatgaccttgtagagggatttttccgcctcattcgacaccca
acggagatagggcctgtgaatttgggaaatccggacgagtacacggtgttggatatggcg
aagaaggtacgggactttgtgcccggaacaaagtcaaacatttgctttctctccccctgc
gaggatgacccgaagcagcgatgcccggacatcagcaaagcgaggcgggtgcttggatgg
acccccgtcgttccgctgtcggaggggctgagacgcacggccgaagattttgcggcgcgt
gtgagtcgtggggagtga

DBGET integrated database retrieval system