KEGG   Trypanosoma cruzi: 509153.90Help
Entry
509153.90         CDS       T01012                                 

Definition
(RefSeq) dihydrofolate reductase-thymidylate synthase
  KO
K13998  dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00240  Pyrimidine metabolism
tcr00670  One carbon pool by folate
tcr00790  Folate biosynthesis
tcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    509153.90
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    509153.90
   00670 One carbon pool by folate
    509153.90
Enzymes [BR:tcr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     509153.90
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     509153.90
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymidylat_synt DHFR_1
Motif
Other DBs
NCBI-GeneID: 3547029
NCBI-ProteinID: XP_815327
GeneDB: Tc00.1047053509153.90
UniProt: Q4DLS1
Structure
PDB: 

AA seq 521 aa AA seqDB search
MSLFKIRMPETVAEGTRLALRAFSLVVAVDEHGGIGDGRSIPWNVPEDMKFFRDLTTKLR
GKNVKPSPAKRNAVVMGRKTWDSIPPKFRPLPGRLNVVLSSTLTTQHLLDGLPDEEKRNL
HADSIVAVNGGLEQALRLLASPNYTPSIETVYCIGGGSVYAEALRPPCVHLLQAIYRTTI
RASESSCSVFFRVPESGTEAAAGIEWQRETISEELTSANGNETKYYFEKLIPRNREEEQY
LSLVDRIIREGNVKHDRTGVGTLSIFGAQMRFSLRNNRLPLLTTKRVFWRGVCEELLWFL
RGETYAKKLSDKGVHIWDDNGSRAFLDSRGLTEYEEMDLGPVYGFQWRHFGAAYTHHDAN
YDGQGVDQIKAIVETLKTNPDDRRMLFTAWNPSALPRMALPPCHLLAQFYVSNGELSCML
YQRSCDMGLGVPFNIASYALLTILIAKATGLRPGELVHTLGDAHVYSNHVEPCNEQLKRV
PRAFPYLVFRREREFLEDYEEGDMEVIDYAPYPPISMKMAV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgtttaagatccgcatgccggagacggtggcggaggggacacgtctcgcactg
cgtgccttttccctcgttgtagcggtcgacgagcacggcggcattggggacgggcggtcg
atcccatggaatgtgcccgaggacatgaagtttttccgggatttgacaacaaaactgcgg
gggaagaacgtcaaaccatcgcctgcgaagcgcaacgccgttgtgatgggccgcaagacg
tgggacagcattccgcccaaattccgcccgcttcccggtcgcctgaacgtcgttttgtcg
tccaccctcacgacgcaacacctcttggacggcctgccagacgaagaaaaacggaatttg
catgccgacagcattgtggcggtaaatggtggactcgagcaggcattgcggttgctcgcg
tcccccaattacacgccgagcattgagacggtctactgcattggtggcggctctgtgtat
gcggaggcccttcgcccgccgtgcgttcatttgctgcaagccatttaccgcaccaccatc
cgcgccagcgagtcttcttgcagcgtgttttttcgcgttcccgagtcgggtacggaggcg
gcggcggggattgagtggcagcgggagacaatctccgaggagctcacgtcggcaaacggc
aacgagacaaagtactactttgagaagctcatcccacgcaacagagaggaggagcagtat
ctaagccttgtggatcgcatcatacgcgaggggaatgtgaagcatgaccgcactggggtg
ggcacgctctccatctttggcgcacagatgcgtttctcgctccgcaacaatcgcctacca
cttttgacaacgaagcgggttttttggcgcggtgtgtgcgaggaactgctgtggtttcta
cggggcgaaacatatgccaaaaagttaagtgacaagggagtccacatatgggacgacaac
ggctcgcgcgcgtttcttgacagtcgtggcctcacagagtacgaggagatggacctcggt
cctgtctacggctttcagtggcgtcactttggtgccgcctacacacaccatgatgccaac
tatgacggacagggtgtggatcaaatcaaggcaatcgttgaaacgctaaagacaaatcct
gacgatcgccggatgctattcacggcatggaatccgagcgctttgcccaggatggcccta
ccaccgtgccacctgctcgcacagttttacgtgagcaatggggaactgtcttgcatgctc
taccagcgctcatgtgacatgggccttggcgtcccgttcaacattgcctcctacgccctc
ttgaccatcctcatcgcaaaggcgacggggctgcggccgggagagttggtgcacaccctt
ggtgacgctcacgtgtacagcaatcacgtcgagccgtgcaatgagcaactgaaacgtgtg
ccacgtgcctttccgtatcttgtgtttcgccgcgagcgcgagttcctggaggactacgag
gagggtgacatggaggtcattgactatgcgccataccctcccatctccatgaagatggcg
gtttag

DBGET integrated database retrieval system