KEGG   Trypanosoma cruzi: 511165.54Help
Entry
511165.54         CDS       T01012                                 

Definition
(RefSeq) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00790  Folate biosynthesis
tcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    511165.54
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tcr04147]
    511165.54
Enzymes [BR:tcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     511165.54
Exosome [BR:tcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   511165.54
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 3540235
NCBI-ProteinID: XP_809601
GeneDB: Tc00.1047053511165.54
UniProt: Q4D5E2
AA seq 114 aa AA seqDB search
MRRATILCASWMPFSQPAITQALQELQGWRMEGNMNKGAICRDFEFRDFKQAMAFMNAVA
VDCERMEHHPSWTNTYNRLQVQLTTHGSGNRVTQKDIDLARRMNDVFREISVSQ
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgggcaacgattttgtgtgccagttggatgccattttcgcaacctgccatcacg
caggcgctgcaggagctgcaagggtggcgcatggagggcaacatgaacaagggcgcgatc
tgtcgtgattttgagtttcgtgacttcaaacaggcgatggcgtttatgaacgccgtggct
gtcgactgcgagaggatggagcaccacccgagctggacgaatacttacaacaggctccaa
gtgcaactcacaacacatggctcggggaaccgtgtcacacaaaaggatatcgatcttgcg
cgtaggatgaacgacgtgtttagagaaatttcagtttcccagtga

DBGET integrated database retrieval system