KEGG   Trypanosoma cruzi: 511211.220Help
Entry
511211.220        CDS       T01012                                 

Definition
(RefSeq) heat shock protein 70
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
tcr  Trypanosoma cruzi
Pathway
tcr03040  Spliceosome
tcr04141  Protein processing in endoplasmic reticulum
tcr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tcr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    511211.220
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    511211.220
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    511211.220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tcr01009]
    511211.220
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tcr03041]
    511211.220
   03009 Ribosome biogenesis [BR:tcr03009]
    511211.220
   03110 Chaperones and folding catalysts [BR:tcr03110]
    511211.220
   04131 Membrane trafficking [BR:tcr04131]
    511211.220
   03051 Proteasome [BR:tcr03051]
    511211.220
   03029 Mitochondrial biogenesis [BR:tcr03029]
    511211.220
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tcr04147]
    511211.220
Protein phosphatases and associated proteins [BR:tcr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     511211.220
Spliceosome [BR:tcr03041]
 Complex B
  Other components
   Prp19 complex
    511211.220
 Complex C
   Prp19-CDC5 complex
    511211.220
Ribosome biogenesis [BR:tcr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    511211.220
Chaperones and folding catalysts [BR:tcr03110]
 Heat shock proteins
  HSP70 / DNAK
   511211.220
Membrane trafficking [BR:tcr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    511211.220
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    511211.220
Proteasome [BR:tcr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    511211.220
Mitochondrial biogenesis [BR:tcr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    511211.220
Exosome [BR:tcr04147]
 Exosomal proteins
  Proteins found in most exosomes
   511211.220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl BcrAD_BadFG CCDC106 FGGY_C FtsA Phage_TAC_11
Motif
Other DBs
NCBI-GeneID: 3549805
NCBI-ProteinID: XP_817743
GeneDB: Tc00.1047053511211.220
UniProt: Q4DTM3
AA seq 680 aa AA seqDB search
MEEFDGTIGIDLGTTYSCVAVFRSDAVEVIPNDQGNRTTPSCVAFHNGDVLVGDSAKQLA
SRGVTGVVYDAKRMIGRKFGEKTIHDDVKRWPFAVEKGENDGVLIRVEHNGETLRLEPEQ
ISARVLAYLKLCAEQFIGKRVKKAVITVPAYFNDAQRERTRAAARIAGLEVLRIVNEPTA
AALCYGLGLGSGAGAQGADCPVNVLVFDFGGGTFDVSIIAIDNGSFAVRSTAGDTHLGGQ
DVDTELLRYVLNDLKNRHGVDATSQPRLLAKLLARCEQAKRVLSHATTEEIVMDGILTGG
EEYALSLSRAKLEELCAKIFARCMAVVQKAMKDAAVTPDDIDDVILVGGSSRIPALRVML
QEMFKGKRLCSSVHPDEAVAIGAAVQASIISTSAEQQSEKTANVVLMDVVPLSIGVEVDD
GKFDVIIRRNTTIPYCATKEYSTVEDNQDEVEVQVFEGERPLTRHNHKLGAFILDGISRA
KKGDPTITVTFSVDADGILTITASEELANVKKTLIVENTERLSDEAVQKMIEVAQKFSAK
DAVAVSIMDATQRLTSGFTELETALAAMPLPLSKKLQRHVAFLTHGKQWLEQQLPNYTET
HAVDVKTTKIMKLVQKAMKTLQRESRKGTENNNESDSGSDDDDDTNENDGDALGGSGGST
PRDSSTGRKRMRSNPRNDEG
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtttgatggtaccatcggcatcgacctcggcacgacgtactcgtgcgtggcg
gtttttcgcagcgacgcggttgaagttattccgaacgatcagggaaaccgcacaacgccg
tcgtgtgtggctttccacaatggtgacgtgttggttggcgacagcgcgaagcagttggcc
tctcgcggggtaacaggtgtcgtgtatgatgcaaagcgcatgattggtcgcaagtttggc
gagaaaaccattcacgatgacgtgaaacgctggccatttgccgttgaaaagggggagaac
gatggtgtactgatccgcgttgagcacaatggggagacacttcgactggagccagagcag
atctctgcgcgagtactcgcgtacctcaaactttgcgccgagcagttcattggcaaacgg
gttaaaaaggctgtcatcacggtgcccgcgtacttcaacgatgcccagcgggaacgcacg
agggctgccgcacggatcgcggggttggaggtgctgcgtattgtaaatgagccgactgcg
gcggcgttgtgttacggccttggccttggctctggcgccggtgcgcagggcgcggattgc
cccgtgaatgtgctggtgtttgactttgggggtgggacgttcgatgtatccatcatcgcc
attgacaatggctccttcgcggtgcggtccacggcgggtgacacacatctcggaggacag
gacgtggacacggagctgctgcgatacgtcctgaatgacttgaagaatcgtcacggtgtg
gatgcaacttcgcagccaaggttgcttgccaaactgctcgcgcggtgcgagcaggcgaaa
cgcgttttgtctcatgcgacgaccgaggagattgtgatggacggcattctgacgggtggg
gaggaatacgcactgtctctctctcgggccaagctggaggagttgtgtgccaaaatcttt
gcccgttgcatggctgttgtgcaaaaggcgatgaaagacgccgcggtaacgccagatgac
attgatgatgtcattctcgttggtggttcgtcacgcattcctgcactacgcgtcatgctg
caggagatgtttaaagggaagcgactctgcagctccgtccacccggacgaggcggtggcg
attggtgccgcagtgcaggcgagcatcatcagcacctcggctgagcaacagtccgaaaag
acggcaaatgttgttttgatggatgtggtgcccctctccattggcgtcgaggtggatgac
ggcaagtttgatgtcatcattcgccgcaacaccaccataccgtattgcgccacgaaagaa
tacagcaccgtggaggacaaccaggatgaggtggaggtgcaggtcttcgagggcgagcga
ccgctgacgcgccacaaccacaaattaggtgctttcattctggatggcatctcacgtgcc
aagaagggcgacccgaccatcacagttacattcagcgtggacgcggacggtattctcacc
attaccgcctccgaggaactcgcaaacgtaaagaagacactcattgttgagaacaccgaa
cgcctcagcgacgaagcggtgcagaagatgattgaagtggcgcagaagttctcggcaaag
gatgcggtggccgtgtctattatggacgcaacgcagcgtcttacaagtggcttcacagaa
cttgaaacggcgctggccgcgatgccactgcccctctcaaagaagttacaacggcatgtg
gcgtttctcacgcacggcaaacaatggcttgagcagcagttgccgaactacacagaaacg
cacgcggtggatgtcaagacaacgaagatcatgaaacttgtacagaaagccatgaagaca
ctgcagcgtgaatcccgcaagggaacagaaaacaacaacgaaagcgacagcggtagcgat
gacgatgacgacaccaatgagaatgatggggacgcactcggaggatcaggcgggtcaaca
ccacgcgactccagtacagggagaaagcgcatgcgcagtaatccaaggaatgatgagggc
tag

DBGET integrated database retrieval system