KEGG   Trypanosoma cruzi: 511439.100Help
Entry
511439.100        CDS       T01012                                 

Definition
(RefSeq) P-nitrophenylphosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     511439.100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase PGP_phosphatase HAD_2
Motif
Other DBs
NCBI-GeneID: 3542419
NCBI-ProteinID: XP_811450
GeneDB: Tc00.1047053511439.100
UniProt: Q4DAN9
AA seq 363 aa AA seqDB search
MSTRTILTAGEAAELLASVRYVLLDVDGVLWAGKHVLPNIPETLSYLRSREKQIRFLTNN
ASISRAGLAREFQRRGIQGVREGEVYNSGFAAALRLQSLFTAEKSTGSDRPLVERNIFVI
GEEGLHEEMRCVLAPGYIAYGMELHDAEKCGGYDAHVVASAWKQRVLPAPLQSSATSCGI
AATGHAAGGISISDLSPAAVVVGLDMHFNMLKLAYASLCLQERPAAQPAGTSSSTPTYFI
ATNEDPQIPVGEDSLLLPGAGGMVSALRTVSGRSPDFVCGKPHVDMAKVLFEAEGITDPQ
QCLMVGDRLTTDIAFGNAAGCKTMLVLSGAEKMDRVRQAERDGHVSLLPDFIAPSLAIFL
PPA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcggacaattctcacggcgggggaggcggcggagcttttggcttctgtacgg
tacgttcttcttgacgtggacggtgtgttgtgggccgggaagcatgtgttgcccaatatt
ccagagacactgtcgtaccttcgctcacgtgagaagcaaattcgttttcttacgaataac
gccagcatttctcgtgctggtctggcgcgggagtttcagcggcgaggcattcaaggggta
cgggagggcgaggtgtacaacagcggctttgcggcggcgctgcggcttcaaagtttgttc
actgcagagaagagcacagggtcggacaggccactggtggagaggaatatatttgttatc
ggtgaggaggggcttcacgaggagatgcggtgtgtattggcacctggatacattgcctac
gggatggagctgcatgacgcggaaaagtgtggcggctacgacgcacacgttgtggcgtct
gcgtggaagcaacgcgtccttccagcgccactccaatcgtccgccacttcctgtgggata
gcagcaacgggccatgcagcgggcggtatctcaatttctgatttatcgcctgctgcggtg
gtggtggggcttgatatgcattttaatatgctcaagctcgcgtacgcttccctctgttta
caggagcggcctgcagcgcagccagcgggcacgtcgtcatctacacccacgtactttatt
gccacaaacgaggatcctcaaataccagttggtgaagactccctgctactcccgggtgct
ggtgggatggtcagcgccctgcgtactgtttctgggcgttctcctgactttgtatgcggc
aaaccgcatgtggacatggcgaaggttctctttgaggctgagggaatcacggatccccag
cagtgcctgatggtgggggacaggctgacaacggatatcgcgtttggaaatgccgctgga
tgtaagacgatgcttgtgctgagtggagcagagaagatggaccgcgtcaggcaggcggaa
cgggatggtcacgtgtcccttttaccagactttatagcaccgtctctcgccatcttttta
ccacccgcatag

DBGET integrated database retrieval system