KEGG   Trypanosoma cruzi: 511635.20Help
Entry
511635.20         CDS       T01012                                 

Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
tcr  Trypanosoma cruzi
Brite
Chromosome and associated proteins [BR:tcr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    511635.20
Exosome [BR:tcr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   511635.20
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF GMP_synt_C ClpB_D2-small
Motif
Other DBs
NCBI-GeneID: 3535096
NCBI-ProteinID: XP_805385
GeneDB: Tc00.1047053511635.20
UniProt: Q4CTD7
AA seq 112 aa AA seqDB search
MATPKSSSANRKKGGKRSHRNPKRTWNVYISRSLKSINNHMSMSGRTMKIVNSFVNDLFE
RIASEAATVVRVNKKRTLGARELQTAVRLVLPADLAKHAMAEGTKAVSHASS
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggccacccccaagagctcgtcggcgaaccgcaaaaagggcggcaagaggtcgcaccgc
aatccgaagcggacgtggaatgtctacatcagccgctcgctcaagtcgatcaacaaccat
atgtcgatgtccggccggacgatgaagattgtgaactcgttcgtgaacgacctctttgag
cgcattgcgtccgaggccgccacggtggtgcgcgtcaacaagaagcgcacactgggtgca
cgcgagctgcagacggcggtgcgcctcgtgctgccggcggacctggcgaagcacgcaatg
gcggagggcaccaaggcggtgtcgcacgcctctagttag

DBGET integrated database retrieval system