KEGG   Trypanosoma cruzi: 511859.170Help
Entry
511859.170        CDS       T01012                                 

Definition
(RefSeq) NADH-cytochrome B5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tcr  Trypanosoma cruzi
Pathway
tcr00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:tcr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    511859.170
Enzymes [BR:tcr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     511859.170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 3547008
NCBI-ProteinID: XP_815311
GeneDB: Tc00.1047053511859.170
UniProt: Q4DLP7
AA seq 306 aa AA seqDB search
MLTYVVAAVIILLTVCLFFKKGVFFSSSMGVALDASKFQNFKLVDKITVSHNSFIFRFAL
HSPTQRLGLPIGQHLHIRCMTTNPEGKPEMVQHAYTPVSSDDDLGHVDFLIKVYFKNVHP
NFPNGGRLSQHLYDLPLGTMVEIRGPVGNFEYLGKGNYTVKDGKGKLKKMHTDAFTMVAG
GTGITPMMQLIRAIMKNKEDRTNIFLVYANQTEDDILLRKELDDCAKDPRMKLWYMLDRE
TSPQWKYGTGYVDEATLRAHVPVLQPRNSDYNRVVALMCGPPPMLQKAVKPNLEKLGYTA
EEMFSF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctcacgtacgtagttgctgcggtcattattttactcacggtatgtctgttctttaag
aagggtgtgtttttctcctcttccatgggagtggcattggatgcgtctaaatttcagaac
tttaagcttgtggataaaattactgtgagtcacaacagttttatctttcgctttgctctc
cactcgcccacacagcgacttggacttcctatcggacaacatcttcacattcgatgcatg
accactaacccagaaggaaagccagagatggtgcaacatgcgtacactcctgtttcctcc
gacgatgacttggggcatgtggatttcctcattaaagtatacttcaagaacgtgcatccc
aattttcccaacggtggccgtctatcgcagcatctgtacgatcttccactgggcacgatg
gtggaaatacggggtcctgtgggaaactttgagtacctggggaaaggcaattacactgtt
aaggacgggaagggcaaattgaaaaagatgcacacggacgccttcacaatggtggcggga
gggacgggtataacaccgatgatgcaactgattcgtgccataatgaaaaataaggaggat
cgcacaaatatttttcttgtctacgcgaatcagaccgaggatgatattctcctgcggaag
gaactggatgactgtgccaaggatccacgcatgaagttgtggtacatgctggaccgtgag
acttcccctcaatggaagtacggcaccggttacgtggatgaagcgacgttgcgggcacat
gttcctgtgctgcagccccggaattccgactacaaccgtgtcgttgcgctgatgtgcggc
ccaccaccgatgctccaaaaagccgtgaagccaaacctggaaaaactcggctacaccgca
gaggagatgttctccttttga

DBGET integrated database retrieval system