KEGG   Trypanosoma cruzi: 511911.159Help
Entry
511911.159        CDS       T01012                                 

Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tcr  Trypanosoma cruzi
Brite
Enzymes [BR:tcr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     511911.159
Chromosome and associated proteins [BR:tcr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     511911.159
   HDAC complexes
    Sin3A-HDAC complex
     511911.159
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    511911.159
  Chromatin remodeling factors
   NuRD complex
    511911.159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 3548686
NCBI-ProteinID: XP_816761
GeneDB: Tc00.1047053511911.159
UniProt: Q4DQU7
AA seq 388 aa AA seqDB search
MAVADIDRPVALIDTSCYSADCSLSALVPQHAMKPYRLLVTMELIKSLGLDRHCRTVVPP
LIGIEQLQTYHAEGYISNLGLHSSQSWLWNTEISKVTFSGDCPPVEGIMEHSLSTVSGSL
MAAILLNSGKADTVIHWGGGMHHAKCGECSGFCYVNDIVIAIIELLKCYKRVLYVDLDMH
HGDGVDEAFCQSNRVFTLSLHKFGESFFPGTGHPRDVGFGNGRHCTMNLALWDGIDDFFY
TTIFEHALSSIVKRYIPDVVVLQCGADSLAGDRLGHFNLSSWGHGKCVEEVKKIGLPMLV
LGGGGYTLRNVAKLWAYETSILCGKKLPLNTVVPVQRMPLSGWLFEGSTQLLVAQDEENK
PLPGVNVQRAFRMVIEQIDKQCPNISFP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgcagatattgatcgtcctgtcgcattaattgacacatcctgctattctgca
gattgtagtctttctgccctggtaccgcaacatgcaatgaagccatatcgtttattagtt
acaatggagcttattaaaagtttgggactagatcgccattgtcgaacagtcgtaccaccc
cttattggaattgaacagttacagacttatcatgcagaaggttacatttcgaaccttggt
cttcatagcagtcaaagttggttatggaatacagaaatttcaaaggtgaccttttcgggg
gattgtcctccagtagaagggataatggaacattcgctttccactgtaagcggttcactt
atggcagccatactcttgaacagtggaaaggctgatactgttattcattggggtggtgga
atgcatcatgcaaaatgtggggaatgctctggattttgttatgtaaacgacatagttatt
gccattattgaactactgaaatgttacaaaagagtcttgtatgtggaccttgatatgcat
catggagatggtgttgatgaggctttttgtcaaagcaatagagtgtttacactatctctt
cataaatttggtgaatcattttttcccggtacggggcacccacgtgacgtaggatttgga
aatggacgtcattgcaccatgaatttggctttgtgggatggtatagatgattttttctac
acgacaatttttgaacatgcactttcctcaattgtgaagcgatacatacctgatgttgtg
gttttacaatgtggtgccgattctttggctggagatcgtcttggacactttaacttatcg
tcatggggacatggaaaatgtgttgaggaagtcaaaaagattggtttgccaatgctggtg
ttgggaggaggaggttataccttaagaaacgttgcaaagctttgggcttacgaaacaagc
attctctgtggtaagaaattgcctttgaatacagttgttcctgtccaaagaatgcccctg
agtggctggttatttgaaggttcgacccagttgttagttgcacaagatgaagaaaacaaa
ccacttcccggtgtcaatgtccagcgagcctttaggatggtcattgagcaaattgataag
caatgtcctaatatcagctttccctaa

DBGET integrated database retrieval system