KEGG   Thermomonospora curvata: Tcur_0589Help
Entry
Tcur_0589         CDS       T01127                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tcu  Thermomonospora curvata
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Tcur_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACY96184
UniProt: D1A4E9
Position
659665..660822
Genome map
AA seq 385 aa AA seqDB search
MTEARETVLNPPPPPGDEPPPLSEQASRVSIKAWLGLLALVLVVIGAGALGLRSDAQTAV
LVLVVVIALGFDYTNGFHDAANAIATSVSTRALTPRAALLMAAVMNLLGALLGVEVAKTV
SEVITPPEGLHGLTVVAAGVLGAITWNMITWYFGLPSSSSHALIGGVVGAGLASASSVSW
GTVVDKVAIPMVVSPVVGFCLAYLVMVAILWIFRRAHPRKIGRRFRIAQSLSAASMALGH
GLQDAQKTMGIIVLALVTTGHADGQSVPLWVIVACASALAAGTYAGGWRIMRTLGRRVIE
LDPPKGFAAEATASAILYATAYIWHAPISTTHTITSCIMGVGATKRLSAVRWGVAGNIVM
AWVLTMPMAALVAGVVYWFVHLFGA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggcgcgtgagaccgtcctgaaccccccgcccccgcccggggacgagccgccc
ccgctcagcgagcaggcctcccgggtatcgatcaaggcctggctggggctgctggcgctg
gtgctggtggtgatcggcgccggagcgctcgggctgcgctcagacgcccagaccgcggtg
ctggtgctggtcgtcgtgatcgccctgggcttcgactacaccaacggcttccacgacgcc
gccaacgccatcgccacctcggtgtccacccgggcgctgaccccgcgcgccgcgctgctg
atggccgcggtgatgaacctgctgggcgcgctgctgggggtggaggtcgccaagaccgtc
agcgaggtgatcaccccgccggaagggctgcacgggctgaccgtggtggccgccggggtg
ctcggcgccatcacctggaacatgatcacctggtacttcgggctgccgtcgtcgtcctcg
cacgccctgatcggcggcgtggtgggcgcgggactggcctcggcctcatcggtgagctgg
gggacggtcgtcgacaaggtcgccatcccgatggtggtctccccggtcgtcggcttctgc
ctggcctacctggtgatggtggccatcttgtggatcttccgccgggcgcacccgcgcaag
atcggccgccggttccgcatcgcccagtcgctgtcggcggcgtccatggcgctggggcac
ggcctgcaggacgcccagaagaccatgggcatcatcgtgctggcgctggtgaccaccggg
cacgccgacggccagagcgtgccgctgtgggtgatcgtggcgtgcgcgagcgcgctggcc
gccggcacctatgcgggcgggtggcggatcatgcgcaccctgggccgccgggtgatcgaa
ctggatccgcccaagggtttcgccgccgaagcgacggcctcggcgatcctgtacgccacc
gcctacatctggcacgctccaatctccaccacccacacgatcacctcctgcatcatgggc
gtcggcgccaccaagcggctgtcggccgtccgctggggcgtggcgggcaacatcgtgatg
gcctgggtgctgaccatgccgatggcggcgctggtggccggcgtcgtctactggttcgtc
cacctgttcggggcatag

DBGET integrated database retrieval system