KEGG   Thermomonospora curvata: Tcur_2961Help
Entry
Tcur_2961         CDS       T01127                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
tcu  Thermomonospora curvata
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tcur_2961
Enzymes [BR:tcu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Tcur_2961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACY98503
UniProt: D1A7Y1
Position
3442059..3442844
Genome map
AA seq 261 aa AA seqDB search
MALCQIPVGDDPAENLEQVRRALARAEGADLAVFPEAVPVRFGNDLTAVAEPLEQGFAGE
LRKLAREHGTALIAGVFEPAGDGRVYNTAVAIDASGRPVGAYRKIHLFDAFGDRESARVA
PGDAPVVVELAGARIGLITCYDVRFPELARALVDRGAQVLVIIAAWAQGVFKEEHWTTLV
RARAIENTTWVVAVDKAPDRTRPPEGGPGGVGRSMLIDPMGTVVADLGPFPAVRVAEIDQ
EVTERVRRILPSLQHRRPDAY
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggcactgtgtcagatcccggtcggcgacgaccccgcagagaacctggagcaggtccgc
cgggcgctggcccgggcggagggcgccgacctggcggtgttccccgaggcggtgccggtg
cggttcggcaacgacctgacggcggtggccgagccgctggagcaggggttcgccggcgag
ctgcggaaactggcgcgcgagcacggcaccgcgctgatcgccggggtgttcgagccggcc
ggcgacgggcgggtctacaacaccgcggtggccatcgacgcctccggacggccggtcggc
gcctaccgcaagatccacctgttcgacgcgttcggggaccgggagtcggcgcgggtggcg
cccggcgacgccccggtggtggtggagctggccggtgcccggatcggcctgatcacctgc
tatgacgtgcgtttccccgagctggcgcgggcgctggtggaccggggggcgcaggtgctg
gtgatcatcgcggcctgggcgcagggggtgttcaaggaggagcactggaccacgctggtg
cgggcccgggcgatcgagaacaccacctgggtggtggccgtggacaaggcccccgaccgc
acccggccgccggagggcggcccgggcggggtgggacgcagcatgctgatcgacccgatg
ggcacggtggtggccgatctgggcccgttcccggcggtgcgggtggcggagatcgaccag
gaggtgaccgagcgggtccgccgcatcctgccgtccctgcagcaccgccgtcccgacgcc
tactga

DBGET integrated database retrieval system