KEGG   Thermomonospora curvata: Tcur_3005Help
Entry
Tcur_3005         CDS       T01127                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate/cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00770  Pantothenate and CoA biosynthesis
tcu01100  Metabolic pathways
Module
tcu_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Tcur_3005
Enzymes [BR:tcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Tcur_3005
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Tcur_3005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Glyco_transf_4 YjeF_N
Motif
Other DBs
NCBI-ProteinID: ACY98547
UniProt: D1A825
Position
complement(3491944..3493146)
Genome map
AA seq 400 aa AA seqDB search
MTPAKPRVVLGVGAGIAAYKVCELLRRLTESGHDVHVVPTRDALRFVGEPTWAALSGNPV
AAEVWTGVDQVPHVRLGQGADLVFVAPATADLLARAACGLADDLLTNTLLTARCPVVFAP
AMHTEMWEHPATQANVATLRERGAIVLEPAVGRLTGADTGKGRLPEPAELFEVARRVLAR
GNAPADLAGRHVVVSAGGTREPIDPVRFIGNRSSGLQGYALARTALARGARVTLVAANVA
LPDPAGAQVVPVGTAEEMRKAVLEAAADADAVVMAAAVADFRPADYRTSKIKKSESGEPE
PIELVRNPDILAELGQHRRPGQVIVGFAAETDDVLANGRDKLVRKKCDLLVVNQVGENLA
FGRPDNAAVVLAADGATTEIPRGPKEDLADVVWDLVVARL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgccaaaccccgggtcgtcctcggggtcggtgccggcatcgccgcgtacaag
gtgtgcgagctgctgcggcggctcaccgagtccggccacgatgtgcatgtcgtgcccacc
cgcgacgccctgcgtttcgtcggcgaacccacctgggcggccctgtcgggcaacccggtg
gccgccgaggtgtggaccggtgtggatcaggtcccgcatgtgcggctggggcagggcgcc
gacctggtgttcgtggcccccgccaccgccgacctgctggccagggccgcctgcgggctg
gccgacgacctgctcaccaacacgctgctgaccgcccgctgcccggtggtgttcgcaccc
gcgatgcacaccgagatgtgggagcacccggccacccaggccaacgtggccacgctgcgc
gagcgcggcgcgatcgtgctggagccggcggtcgggcggctgaccggcgccgacaccggc
aagggccggctgccggagccggccgagctgttcgaggtcgcccgccgggtgctggcccgc
ggcaacgcccccgccgacctggccggccggcacgtggtggtctccgccggcggcacccgc
gagccgatcgacccggtccgcttcatcggcaaccgctcctccggcctgcaggggtacgcg
ctggcccgcaccgcgctggcccgcggcgcccgcgtcacgctggtggcggccaacgtggcg
ctgcccgacccggcgggcgcccaggtcgtgccggtgggcaccgccgaggagatgcgcaag
gccgtgctggaggcggcggccgacgccgacgcggtggtgatggccgcggcggtggccgac
ttccggcccgccgactaccgcacctccaagatcaaaaaatccgagtcgggcgagcctgag
ccgatcgagctggtacgcaaccccgacatcctggccgagctggggcagcaccgccgcccc
gggcaggtgatcgtggggttcgccgccgagaccgacgacgtgctggccaacggccgcgac
aagctcgtccgcaaaaagtgcgacctgctggtggtcaaccaggtcggggagaacctcgcc
ttcggccgtcccgacaacgccgccgtggtactggccgccgacggcgcaaccaccgagatc
ccacgcggccccaaagaggacctcgcggacgtggtatgggacctggtcgttgcgcgcctg
tag

DBGET integrated database retrieval system