KEGG   Thermomonospora curvata: Tcur_3867Help
Entry
Tcur_3867         CDS       T01127                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00471  D-Glutamine and D-glutamate metabolism
tcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Tcur_3867
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tcu01011]
    Tcur_3867
Enzymes [BR:tcu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Tcur_3867
Peptidoglycan biosynthesis and degradation proteins [BR:tcu01011]
 Precursor biosynthesis
  Racemase
   Tcur_3867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ACY99396
UniProt: D1AD87
Position
complement(4413519..4414331)
Genome map
AA seq 270 aa AA seqDB search
MSDAPIGIFDSGYGGLTVARAILDQLPDEPILYLGDSARQPYGPRPIAEVRAFALQMLDQ
LVAEGVKMLVIACNSASAAMLRDARERYDVPIVEVIKPATRRAARATTNGRVGLIATHAT
VTSRAYEDAFAAAPHIELTSVACPRFVEFVEAGITKGPELLSVARSYLQPIVDAGCDTLI
LGCTHYPLLIGAISYVVGDGVTLVSSAEETAKDVYRVLQDQGLARAETASPPVHRFLVTG
DPAEFARLGRRFLGPEIGLVEAVAGAALTP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgcgccgatcgggatcttcgacagcggctacggagggctcaccgtcgcccgt
gcgattctcgatcagctgccggacgagccgatcctctatctcggcgactcggcgcgtcag
ccctacggcccccggccgatcgccgaggtccgcgccttcgccctccagatgctcgaccag
ctggtcgccgagggcgtcaagatgctggtgatcgcctgcaacagcgccagcgcggcgatg
ctgcgggacgcgcgcgaacgctacgacgtgccgatcgtggaggtcatcaagcccgccacc
cggcgggccgcacgggccaccaccaacgggcgggtgggactgatcgccacccacgccacc
gtcaccagccgggcctatgaggacgcgttcgccgccgccccgcacatcgagctcaccagc
gtcgcctgcccccgtttcgtggagttcgtcgaagccggcatcaccaaggggccggagctg
ctgtcggtggcgcgctcctaccttcagccgatcgtggatgcgggctgcgacaccctcatc
ctcggctgcacccactaccccttgctcatcggcgccatttcctacgtggtaggggacggg
gtcacactggtctcaagtgccgaggagaccgctaaggacgtataccgagtgcttcaagac
cagggtctggcccgcgccgagaccgcgtccccacccgtgcaccggttccttgtcaccggg
gatccggcggagttcgcgaggctgggacgcaggttcctggggcccgagataggcctggtg
gaggccgtcgcgggcgccgccctgaccccttga

DBGET integrated database retrieval system