KEGG   Thermomonospora curvata: Tcur_4248Help
Entry
Tcur_4248         CDS       T01127                                 

Definition
(GenBank) glucose-methanol-choline oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
tcu  Thermomonospora curvata
Pathway
tcu00984  Steroid degradation
tcu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tcu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Tcur_4248
Enzymes [BR:tcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Tcur_4248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N FAD_binding_2 Pyr_redox_2 DAO NAD_binding_8 GIDA Fer4_9 FAD_binding_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ACY99775
UniProt: D1A305
Position
complement(4848597..4850357)
Genome map
AA seq 586 aa AA seqDB search
MSADVKFDFDVLVVGSGFGGSVAALRLTEKGYKVAVAEIGRRFDDPAGRPGERHAALPKN
SWRLRRYLWAPALGLTGVQRIHLLRGEKGGRVLVLAGAGVGGGSLVYANTLYEPLQPFYD
DPQWRHITDWRAELAPYYDQAKRMLGVVPNPTMTPADRAMKRVAERMGRGETFHLTPVGV
LFGDKPKQEVDDPYFGGIGPRRRTCHECGECMTGCRHGAKNMLTENYLYLAEKAGAKIMP
MTGVRSVTPLPGGGYEVEIVRTGSFGRHRRTLRVEQVVFAAGTYGTQKLLHRMKATGRLP
RISDRLGVLTRTNSEAILGAERFRRRGDDYSAGVAITSSFHPDEDTHIEPVRYGKGSNAM
GLLRTLLIDGPSADGSGAAPRWLKFLGYAVTHLWQLPRLLNLRHWSERTIIALVMQVRDN
SITVTPRKGLFGWGLRARRGHGEPNPTWIPAGHQATRLLAEEIGGMPGGSWLDLGDIPTT
AHFIGGCAIGDSPQTGVIDPYHRLYGHEGLHVVDGSAISANLGVNPSLTITAQAERAMAM
WPNKGEQDPRPPLGSPYRRITPVAPKNPVVPQAAPAALRLPIVEIT
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggacgtgaaattcgacttcgatgtgctggtggtcggctcgggcttcggcggc
agcgtcgcggcgctgcggctgaccgaaaagggctacaaggtcgccgtggccgagatcggc
cgccgtttcgacgacccggccggcagaccgggggagcgccatgcggcgctgccgaagaac
tcctggcggctgcggcgctacctgtgggcgccggcgctgggcctgaccggcgtccagcgc
atccacctgctgcgcggcgagaagggcggccgggtgctggtgctggccggggcgggtgtc
ggcggcggctccctggtgtacgccaacaccctgtatgagccgctgcagccgttctacgac
gacccgcagtggcggcacatcaccgactggcgggccgagctggcgccctactacgaccag
gccaagcggatgctgggcgtggtgcccaaccccaccatgacccccgccgaccgggcgatg
aagcgggtcgccgagcggatgggacggggcgagaccttccacctcaccccggtgggggtg
ctgttcggcgacaagccgaagcaggaggtcgacgacccctacttcggagggatcggcccg
cgccgccgcacctgccacgagtgcggggagtgcatgaccggctgccggcacggcgccaag
aacatgctcaccgagaactacctgtacctggccgagaaggcgggcgccaagatcatgccg
atgaccggcgtgcgctcggtgaccccgctgccgggcggcgggtacgaggtggagatcgtg
cgcaccggctccttcggccggcaccgccgcaccctgcgggtcgagcaggtggtgttcgcc
gccggcacctacggcacccagaagctgctgcaccggatgaaggccaccgggcgcctgccg
cgcatctccgaccggctgggcgtgctcacccggaccaactccgaggcgatcttgggcgcc
gaacggttccgccgccggggcgacgactattcggcgggcgtggcgatcacctcctccttc
cacccggacgaggacacccacatcgagccggtccgctacggcaagggctccaacgccatg
ggcctgctgcgcaccctgctgatcgacggcccgtccgccgacggctccggcgcggccccg
cgctggctgaagttcctcggctacgccgtcacccacctgtggcagctgccccggctgctc
aacctgcggcactggtcggaacgcaccatcatcgccctggtcatgcaggtgcgggacaac
tccatcaccgtcaccccgcgcaagggcctgttcggctggggactgcgggcccgccgcggc
cacggcgagcccaaccccacctggatcccggccgggcaccaggccacccggctgctggcc
gaggagatcggcggcatgcccggcgggtcctggctggacctcggcgacatccccaccacc
gcgcacttcatcggcggttgcgccatcggcgactccccgcagaccggagtgatcgacccc
taccaccgcctctatggccatgagggcctgcacgtggtggacggctcggcgatctcggcc
aatctgggcgtcaacccgtccctgaccatcaccgcccaggccgagcgtgcgatggcgatg
tggcccaacaagggcgagcaggacccgcgtcccccgctgggctcgccctatcgccgcatc
accccggtggcccccaagaaccccgtggttccccaggccgccccggccgcgctgcggctg
ccgatcgtcgagatcacctga

DBGET integrated database retrieval system