KEGG   Thermomonospora curvata: Tcur_4316Help
Entry
Tcur_4316         CDS       T01127                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
tcu  Thermomonospora curvata
Pathway
tcu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tcu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Tcur_4316
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tcu03011]
    Tcur_4316
Ribosome [BR:tcu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Tcur_4316
  Bacteria
    Tcur_4316
  Archaea
    Tcur_4316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACY99843
UniProt: D1A373
Position
complement(4909059..4909436)
Genome map
AA seq 125 aa AA seqDB search
MEARARARYVRVTPRKARRVVDLIRGLPAAEAQTVLRFAPQAASEPVGKVLASAIANAEH
NFKLNRDTLVVSRAWVDEGPTLKRFRPRAQGRAYRINKRTSHITVVVESREDAASGNGGR
KRRAR
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggaagccagggcccgagcgcggtacgtccgcgtcacgcccaggaaggcccgccgcgtg
gtggacctcatccgcggcctgcccgccgcggaggcccagacggtgctgcggttcgccccc
caggctgcgagcgagccggtgggcaaggtgctggcgagcgccatcgccaacgccgagcac
aacttcaagctcaaccgtgacacgctcgtggtgagccgggcgtgggtcgacgaggggccc
acgctcaagcggttccggccgcgcgctcagggccgggcctaccggatcaacaagcgcacc
agccacatcaccgtggtcgtcgagtcccgcgaggacgcggcgtctggtaacggcggcagg
aagaggagggcccgctag

DBGET integrated database retrieval system