KEGG   Hydrogenovibrio crunogenus: Tcr_0211Help
Entry
Tcr_0211          CDS       T00296                                 

Definition
(GenBank) Iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00010  Glycolysis / Gluconeogenesis
tcx00071  Fatty acid degradation
tcx00350  Tyrosine metabolism
tcx00625  Chloroalkane and chloroalkene degradation
tcx00626  Naphthalene degradation
tcx01100  Metabolic pathways
tcx01110  Biosynthesis of secondary metabolites
tcx01120  Microbial metabolism in diverse environments
tcx01130  Biosynthesis of antibiotics
tcx01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcr_0211
  Lipid metabolism
   00071 Fatty acid degradation
    Tcr_0211
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tcr_0211
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tcr_0211
   00626 Naphthalene degradation
    Tcr_0211
Enzymes [BR:tcx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tcr_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABB40807
UniProt: Q31J66
Position
complement(250246..251433)
Genome map
AA seq 395 aa AA seqDB search
MIADFQIANLPKIQFGWGIRDQFAQAIAEQGFQSIVLISGQFLARPGGFSAALITQLQQA
NIRVNVFVVSGEPSPNLVDEIVKASPNNADAVIGIGGGSVLDAAKAVAGLIPSQTSVMDY
LEGVGKGLKLAGNTLPFIAMPTTAGTGSETTKNAVLSRLGEFKKSFRDDKLLAKEVWLDP
SFLPTCPHEVLYSTGMDAFTQLLESYTTLKANPITDALAWQGMTLFNGAFKAINSDNFEQ
QKTGYGNLMLAASLSGITLANAGLGAVHGLAGPIGAFFEAPHGVLCAALLAPITEANIQA
LKQSDEPHAESTLTKYAQIGTLLSGASNHTTDSLTALIEHLQQLTTTYLPNRLSEYGLHE
DNLAPVLTNCRSGSMTGNPLILSDEVLMSAIRQTL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagactttcaaatcgccaacctccctaaaattcaattcggctgggggattcga
gatcaatttgcacaagccatagcagaacaaggctttcaatctatcgtgctcatttcaggt
caatttttggccaggcctggcggtttttcagcggcgttgatcacccaactgcaacaagcc
aatattcgcgtcaatgtctttgttgtgtccggcgaaccctctccgaatctggtggatgaa
atcgtcaaagccagtccaaacaacgccgatgctgtgatcggcattggtggtggaagcgta
ttggatgccgccaaagcggtggccggtttgattcccagccaaacgtccgtgatggattat
ctcgaaggcgttggcaaagggcttaaattggcgggcaataccctgccttttatcgcgatg
ccaaccaccgccggcaccggcagcgaaaccaccaaaaacgcggttttgtcccgtttaggc
gaattcaaaaaatcctttcgcgatgacaagcttctcgcaaaagaagtgtggttagatccc
agctttcttccgacctgcccgcatgaagtgctttacagcacgggcatggatgcctttacc
caattattggaatcgtacacaacgctcaaagccaacccgattaccgatgcactggcatgg
caaggcatgactttatttaacggtgccttcaaagccatcaacagtgataattttgaacag
caaaaaaccggctatggcaacttaatgctggcggccagtttatccggcatcactctcgcc
aatgctggattgggcgctgtccatgggttagctgggccaatcggagccttttttgaagcg
ccccatggcgtgctgtgtgcggcgttactcgcaccgattaccgaagcaaacattcaagcc
ctaaaacagtcagatgagccccatgcagaaagcaccttaaccaaatacgctcaaataggt
accttattgtcaggcgcgtcaaaccatacgacagactctctcaccgcattaatcgaacac
ttacaacagctgacaaccacgtaccttcctaaccgactatcggaatatggattgcacgag
gataacctggcgccggttctaacaaactgtcgttcagggagcatgacaggaaaccctttg
attttatccgatgaggttctcatgtcagcaattcgacaaaccttataa

DBGET integrated database retrieval system