KEGG   Hydrogenovibrio crunogenus: Tcr_0501Help
Entry
Tcr_0501          CDS       T00296                                 

Definition
(GenBank) coproporphyrinogen III oxidase, anaerobic
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00860  Porphyrin and chlorophyll metabolism
tcx01100  Metabolic pathways
tcx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tcr_0501
Enzymes [BR:tcx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     Tcr_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ABB41097
UniProt: Q31IC6
Position
560702..562084
Genome map
AA seq 460 aa AA seqDB search
MEQSIRFDEDLIKRYNQSGPRYTSYPTAVQFDETFGVADYQAAAERSNASDRNLSLYFHI
PFCDTVCFFCACNKVWTRDRSKTTPYLARLYQEVEMQAKLFDSNRKVDQLHWGGGTPTFI
NMDEMRELMAVTRKHFNLHDDDSGEYSIEIDPREANKESVKLLRELGFNRMSLGVQDFDP
NVQKAVNRIQTEAQTFEVLEGAREAGFMSVNVDLIYGLPHQTESGFMATLDKVLEVAPDR
FSIFNYAHMPSMFPTQKKMNEADMPSPDEKLAILHATTNRLLEAGYVYIGMDHFAKPDDE
LAVAQRNETLYRNFQGYSTHAECDLIGMGATSISLINNTYAQNHKSLNDYYQAIDAGHLA
VFRGVELTEDDELRRDVITRLISHFHLNFASVEAQWGIVFKEYFEQEMNALVPMIEDGLI
ELSDSDLYVTAAGRLLIRNICMAFDAYLKQGTQNRFSKVI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatctattcgatttgatgaagacttgatcaaacggtataaccaatcaggtcct
aggtatacgtcttatccaacggcggtacagtttgatgaaacgtttggcgtagcggattac
caagccgctgcggaacgcagtaatgcttcagatcgaaatctctcattatattttcatatt
cctttttgtgatacggtgtgttttttctgtgcctgtaataaagtctggacacgtgatcgt
agcaaaacgaccccttatttagcgcgtttgtatcaagaagttgaaatgcaggctaagttg
tttgattcgaaccgaaaagtagaccaattgcattggggaggcggtacgccaactttcatc
aatatggatgaaatgcgtgaattaatggccgttacccgcaagcattttaatttacacgat
gatgactcaggcgaatattcgattgagattgatccgagagaagccaataaggaatccgtt
aaattattgcgagagcttgggtttaaccggatgagtttaggggtgcaggattttgaccct
aacgtacaaaaagccgtgaatcgaattcaaaccgaggcgcaaacctttgaggtgctggag
ggcgctcgtgaagccggatttatgtcggtgaatgtggatttgatttacgggttaccgcac
caaaccgagtccggttttatggcgactttagataaggtgctggaagtggcgccggatcgc
ttttcgatttttaactatgcccacatgccaagcatgttcccgacacaaaagaaaatgaac
gaagcggacatgccttcgccggatgaaaaactggcgattttgcatgccacaaccaatcgt
ttattggaagcgggttatgtttatatcggcatggatcattttgccaagccagatgatgaa
cttgcggttgcacaacgtaatgaaacgctttatcgaaattttcaaggctattctacccat
gccgaatgtgacttgattggcatgggggccacgtcgatttcattgattaacaatacctat
gcacaaaatcataaaagcctgaatgattattatcaggcgattgatgctgggcatctcgct
gtgttcaggggggtggaattgactgaagatgatgagctgcgtcgtgatgtgattacacgt
ttaatcagtcatttccatctgaatttcgccagcgttgaagctcagtggggtattgtgttt
aaagagtactttgagcaagaaatgaacgcattggttccgatgattgaagacggtttgatc
gagttatctgactcggatttgtatgtcaccgcggcagggcgattattgatccgaaatatt
tgtatggcatttgatgcttatttaaaacaaggcactcaaaaccggttttcaaaagtgatt
taa

DBGET integrated database retrieval system