KEGG   Hydrogenovibrio crunogenus: Tcr_0549Help
Entry
Tcr_0549          CDS       T00296                                 

Definition
(GenBank) lipase/acylhydrolase domain protein
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Tcr_0549
Enzymes [BR:tcx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Tcr_0549
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Tcr_0549
Lipid biosynthesis proteins [BR:tcx01004]
 Fatty acid synthase
  Component type
   Tcr_0549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL OSK TINF2_N
Motif
Other DBs
NCBI-ProteinID: ABB41145
UniProt: Q31I78
Position
complement(613747..614406)
Genome map
AA seq 219 aa AA seqDB search
MSQRILIVLLATLSYVSVAQAFEKPNPASKNSSQNLLVLGDSLSAAYGMRVTQGWVALLA
DRLQSKNIRVINASISGDTTSGGKNRLPSLLKTHQPNWVIVELGANDALRGQSLQATQRN
LQTIIDLSQKTGAKVLLLGIRLPTNYGPAYDQMLQQTFKQVATQNQLLFDPFFLETVALE
PDLMQSDGLHPNADAQPKILERLWPLIQELITSSTKQAA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcaaaggattctcattgtcttgctagcgacgctcagttacgtcagtgtagcgcaa
gcctttgaaaaacccaatcctgcgtcaaaaaattcttctcaaaatttattagtcttgggc
gacagtttaagtgccgcttatggcatgagggtaacacaaggctgggtggcattactggca
gaccgactgcagtcaaaaaacattcgcgtcattaacgccagcatcagtggtgacacgact
tctggaggaaaaaatcggttacccagcctgctgaaaacccatcaaccaaactgggtgatt
gtggaactgggcgcgaacgatgccttacgtggccaatctctccaagccacgcagcgtaat
ttacaaaccatcatcgatttaagccagaaaacaggcgccaaagttttgttgctcggcatt
cgattgcccaccaattatggaccggcttatgaccagatgctgcaacaaacgttcaaacaa
gtggccactcaaaatcagctgttatttgaccctttctttttggaaaccgttgcgttagaa
cccgatttgatgcagtccgacgggctccaccctaatgccgatgctcagcctaaaatatta
gaacggctttggccactcattcaggaactcatcacctcttcaacaaagcaagcggcctaa

DBGET integrated database retrieval system