KEGG   Hydrogenovibrio crunogenus: Tcr_0815Help
Entry
Tcr_0815          CDS       T00296                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00010  Glycolysis / Gluconeogenesis
tcx00051  Fructose and mannose metabolism
tcx00562  Inositol phosphate metabolism
tcx01100  Metabolic pathways
tcx01110  Biosynthesis of secondary metabolites
tcx01120  Microbial metabolism in diverse environments
tcx01130  Biosynthesis of antibiotics
tcx01200  Carbon metabolism
tcx01230  Biosynthesis of amino acids
Module
tcx_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tcr_0815
   00051 Fructose and mannose metabolism
    Tcr_0815
   00562 Inositol phosphate metabolism
    Tcr_0815
Enzymes [BR:tcx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tcr_0815
Exosome [BR:tcx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tcr_0815
  Exosomal proteins of bladder cancer cells
   Tcr_0815
  Exosomal proteins of melanoma cells
   Tcr_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABB41411
UniProt: Q31HG2
Position
888176..888937
Genome map
AA seq 253 aa AA seqDB search
MRQLFVAGNWKMHGDKASIKTLVTGLNAKADSVGDVLVAVCPPAIYLDYTKNCLMAGEIA
LGGQNMAIEPVQGAYTGETSASMLKDVGCQYVILGHSERRAIYGETDQDIAAKVKTALDS
GLTPILCVGETLEERESGQLESVISQQLDAVISEVGIDQFADVVIAYEPVWAIGTGKTAS
AQQAQDVHAFIRGQLAKLNPSVAEKVIIQYGGSVKPNNASELFSQPDIDGGLIGGASLNA
DDFIAICQAAGEQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagacagttatttgttgctggtaattggaaaatgcatggtgataaggcatccattaaa
acacttgtgactggtttgaatgcgaaagcagacagtgttggggatgtattggtagcggtg
tgtccgcctgcaatttatcttgattatacaaaaaactgtttaatggcgggtgaaattgca
ttaggtggtcaaaatatggcaattgagccagtgcaaggtgcttatacaggtgaaacatca
gcctctatgttaaaagatgttgggtgccagtacgttattttagggcattcagaacgtcga
gctatttacggtgaaacagatcaagacatcgcagccaaggtgaaaaccgcattagattca
ggattaacgcctattttatgtgtgggcgaaacgcttgaagagcgtgaatcaggtcaattg
gagtcggtcatttctcaacagttggatgcggtgatttccgaagttggtattgatcagttt
gcagatgttgtaattgcttatgaacccgtgtgggcaatcgggactggaaaaacagccagt
gcccagcaagcacaagatgttcatgcctttattcgtggacaacttgcgaagttaaatcct
tcggttgcagaaaaagtcattattcaatacggtggaagcgttaagccaaataacgcttct
gaattatttagtcagccagatatcgatggtgggttgattggtggtgcttcattaaatgca
gatgactttattgcaatatgtcaggctgcaggagaacaataa

DBGET integrated database retrieval system