KEGG   Hydrogenovibrio crunogenus: Tcr_1216Help
Entry
Tcr_1216          CDS       T00296                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00860  Porphyrin and chlorophyll metabolism
tcx00970  Aminoacyl-tRNA biosynthesis
tcx01100  Metabolic pathways
tcx01110  Biosynthesis of secondary metabolites
tcx01120  Microbial metabolism in diverse environments
Module
tcx_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
tcx_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tcx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tcr_1216
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tcr_1216
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tcx01007]
    Tcr_1216
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tcx03016]
    Tcr_1216
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:tcx02048]
    Tcr_1216
Enzymes [BR:tcx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Tcr_1216
Amino acid related enzymes [BR:tcx01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Tcr_1216
Transfer RNA biogenesis [BR:tcx03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Tcr_1216
 Prokaryotic Type
   Other AARSs
    Tcr_1216
Prokaryotic defense system [BR:tcx02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Tcr_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ABB41811
UniProt: Q31GB2
Position
complement(1332564..1333976)
Genome map
AA seq 470 aa AA seqDB search
MVKTRFAPSPTGYLHIGGVRTALFSWLYAKQKKGEFTLRIEDTDLERSTQESVQAILDGM
AWLGLDYDKGPIYQTERFDRYKAVIQDLMDRGLAYYCYASPEELDEMREAQKARGDKPRY
DGRYRDFDGTPPEGVKPVIRFKNPEDGEVVIDDLVKGRIVVANKELDDLVIARSDGTPTY
NLTVVVDDWDMEMTHVIRGDDHINNTPRQINLYKALGAEPPKFAHIPMVLGEDGSRLSKR
HGAVSVLQYKEDGFLPEALLNYLVRLGWSYKDQEIFTIQEMIDLFQLESVNASPSTFNLE
KLLWINQQHIQMTDIDNLVKNLKPFMDQKGIDTEKGPELSHVANLLRERAKTLIEMADSA
AYFYQDFTEFEAGAAKKHLRPVAEEPLRLVQKKFAELTEWKADKIHEAVHQAAEDLEIGM
GKVGMPLRVAITGGGQSPSIDATAELIGQQKCVARIDLALQAIEARKANS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaaaactcgctttgctcccagcccaacaggctatttgcacattggtggcgttcgt
acagcgcttttttcatggctttatgctaagcagaaaaaaggggagtttaccttacgtatt
gaagacacggacttagagcgttcaactcaggaatctgttcaagcgatcctggatgggatg
gcgtggttaggtctggattatgataagggacccatttaccaaacagagcgctttgatcgt
tataaggctgttattcaggatttgatggatcgtggcctggcttactattgctatgcgtca
cctgaagagctggacgaaatgcgagaagcacagaaagcacgtggtgataagccgcgttac
gatggacgttatcgcgattttgatggcacaccgccagaaggcgtgaagccggttattcga
ttcaaaaacccggaagatggggaagtagtgattgacgatttggtgaaaggtcgaattgtt
gttgccaataaagaattggatgatttggtcattgcgcgttcagatggcacgccgacgtat
aacttaacggttgtggtggacgactgggatatggagatgacgcacgttattcgtggtgat
gaccatattaataatacaccacgccaaattaacctttataaagcattgggcgcagagcca
ccaaagtttgcgcacattcctatggtattaggtgaagatggtagccgcttgtctaaacgt
catggcgcggtttcggttttacaatataaagaagatgggtttttgccggaagcactgctt
aattatctggtgcgtttagggtggtcatataaagatcaggaaatctttaccattcaggaa
atgatcgatttattccaattggagtcagtcaatgcatccccatcgacctttaacttggaa
aagttgttgtggattaaccaacagcatattcaaatgacggacattgataatttggtcaaa
aacttaaaaccgtttatggatcaaaaagggattgataccgaaaaggggccagaattgtct
catgttgcaaacttattgcgtgaaagagcgaaaacgttaattgaaatggcggacagcgcg
gcgtatttctaccaagactttaccgagtttgaagcgggggctgccaaaaagcatttacgc
ccagtggcagaagagccattacgattggtgcaaaagaagtttgctgagttgaccgaatgg
aaagccgacaaaattcatgaagccgttcaccaggctgcagaagatctcgaaatcggtatg
gggaaagtagggatgccattgcgtgttgcgattacagggggcggtcagtcaccgtctatt
gatgcgacagcagaattaattgggcaacagaaatgtgtggcacgtattgatttggcttta
caagcaattgaagcgagaaaagctaacagttag

DBGET integrated database retrieval system