KEGG   Hydrogenovibrio crunogenus: Tcr_1291Help
Entry
Tcr_1291          CDS       T00296                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00300  Lysine biosynthesis
tcx01100  Metabolic pathways
tcx01120  Microbial metabolism in diverse environments
tcx01230  Biosynthesis of amino acids
Module
tcx_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tcx00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tcr_1291
Enzymes [BR:tcx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Tcr_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ABB41886
UniProt: Q31G37
Position
1406589..1407725
Genome map
AA seq 378 aa AA seqDB search
MSETIQLAQKLIQTESVTPNDNGCQTLIADYLKPLGFDIEPMPFGEVENLWARAGKDGPV
IVFAGHTDVVPTGPEEKWTHPPFSAHIDADGIMYGRGTADMKSSIACFMVATKQFIKQYP
DFKGSIAFLITSDEEGPAVNGTVKVIEALEARNEKFEYCLVGEPSSSNTLGDSIKNGRRG
SLSGHLTIKGIQGHIAYPQLAENPIHTLSPALSDMVNKVWDKGNDYFPPTSFQVSNIHSG
TGATNVIPGDCVVDFNFRFSTEQTPESLKAGIHQILDSHQLNYDLDWNLSGLPFITPADG
ELIQAVSKAIEQEMGTTPELSTGGGTSDGRFIAQTGAQVIELGPLNDTIHKIDERVSVSD
LEKLTQIYRNTLINLLVT
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaccattcaacttgctcaaaaactgattcaaaccgaatcggtcacgccaaat
gacaacggctgtcaaacccttattgccgattacttaaagccacttggttttgacatcgaa
ccgatgccattcggggaggttgaaaacttatgggcaagagcaggcaaagatggcccggtg
atcgtttttgcaggccatactgatgtcgtcccaaccgggccggaagaaaaatggacacac
ccgcctttctccgcgcacattgatgccgatggcataatgtacggacgcggtaccgcagac
atgaaaagcagcattgcctgctttatggttgcaaccaaacaattcatcaagcaatatcca
gattttaaaggctccatcgctttcttgatcaccagcgatgaagaaggcccggcggtcaat
ggaaccgttaaagtcatagaagctttggaagctcgtaatgaaaaatttgaatattgcttg
gtcggagaaccttccagcagtaacaccttaggtgattccattaaaaacggtcgccggggg
tctttaagcggacacttgaccataaaagggatccaagggcacattgcctacccgcaattg
gccgaaaacccaatccataccctttctcctgctttaagtgacatggtgaacaaagtctgg
gataaaggtaacgactactttccaccgacgtcgtttcaggtatcaaacattcattccgga
acaggcgcaaccaatgttattccaggagattgtgttgttgattttaacttccgcttttca
accgaacaaacgccagagagtctaaaagccggcattcatcaaattttagacagccatcaa
ctcaactatgacttggattggaacttatcaggactgcccttcatcacgcccgcggatggc
gagttaattcaagcggtctcaaaagcgatcgagcaggaaatgggaaccactcctgagctt
tcaaccggtggcggtacctctgatggccgctttattgcacagacaggtgcacaagtgatt
gaattaggtccgttaaatgatactattcataaaatagatgaacgtgtcagcgtatcagat
ttagaaaaattaactcaaatctaccggaacaccctcattaacttattggtgacgtaa

DBGET integrated database retrieval system