KEGG   Hydrogenovibrio crunogenus: Tcr_1671Help
Entry
Tcr_1671          CDS       T00296                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tcx  Hydrogenovibrio crunogenus
Brite
Enzymes [BR:tcx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tcr_1671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_23 Methyltransf_11 RrnaAD Methyltransf_31 Methyltransf_12 NodS MTS Ubie_methyltran Methyltransf_24 Methyltransf_4 Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: ABB42263
UniProt: Q31F10
Position
1824830..1825477
Genome map
AA seq 215 aa AA seqDB search
MNYEQARFNMVEQQIRPWDVLDPKVLDLFMSTPRHDFVAESQQALAYSDIELPIGEGQTM
LPPRIEARILQALDTAENESVLEVGTGSGYTTALLAKSANEVTTVEIFPSLQEIAKTRLN
DFNNIHFEQGDAAQNWEDGKSYDVIFLTGAVASVPEAYKQKLNLGGRLALTVGQDHVMTT
QILTRVSDTEWETETLFETVLPFLINAEAKDTFTL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaactatgagcaagcacgctttaacatggtagagcaacaaatacgcccttgggacgtg
ttagaccctaaagtactcgacttgttcatgtcgacgcctcgtcatgattttgtggccgag
tcacagcaagcgcttgcttatagcgacattgaattacccattggcgaagggcaaaccatg
cttcctcccagaattgaggcacgcattttacaagccttagacaccgcagaaaatgaaagc
gtactggaagtgggaacagggtcaggttacaccacggcattattagccaaaagcgctaac
gaagtgacgaccgttgaaatcttcccctccctacaagaaatcgctaaaacgcgtttaaac
gattttaacaacattcattttgagcagggagatgccgctcaaaactgggaagatggtaaa
agctatgatgtgatttttctaacaggagccgtcgcaagtgttccagaagcctacaaacaa
aaattaaatttaggcgggcgtctggcccttactgtgggacaagatcacgtgatgacgact
caaatcttaacccgagtcagcgacacggaatgggaaaccgaaacactgtttgaaaccgtg
ttaccttttttgattaatgccgaagctaaagacacctttacgctttaa

DBGET integrated database retrieval system