KEGG   Hydrogenovibrio crunogenus: Tcr_1678Help
Entry
Tcr_1678          CDS       T00296                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase (GDP)
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
tcx  Hydrogenovibrio crunogenus
Pathway
tcx00051  Fructose and mannose metabolism
tcx00520  Amino sugar and nucleotide sugar metabolism
tcx01100  Metabolic pathways
tcx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Tcr_1678
   00520 Amino sugar and nucleotide sugar metabolism
    Tcr_1678
Enzymes [BR:tcx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Tcr_1678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding SecA_DEAD
Motif
Other DBs
NCBI-ProteinID: ABB42270
UniProt: Q31F03
Position
complement(1831680..1833083)
Genome map
AA seq 467 aa AA seqDB search
MINIILCGGSGTRLWPLSRTMLPKQFVRLFDGYSLFQDTVIRNQSVCRHSFVISNTEQYF
LAVDQLSQVSSQPSRFLLEPVGRNTAPAIALACLALDEDDLVFVTTSDHLVKDQGAYENA
VIKAKSLAEQGNLVTFGIQPTYPETGFGYIEASGNDVLSFKEKPSAKLARSYLEAGNYYW
NSGMFCFKAGVFLAELQKHSPEIYEASLRAMRSVKEECASQDDKVIKIDLDAMQSIPEDS
IDYAVMEKSDIVKVVPCDMGWSDLGSFDALYDEVKDDSNENAVLSRLDKSPLPICIDSKN
NLLVTRDRQLALVDVEDLLVVDTSDAILISKKGSSQKVKQVVSMIKKQSPELAEIHRLAH
RPWGTYEVLIDSEQYKVKRIVVKPGSKLSLQKHFHRNEHWIVVSGTASVTVDKETFLVRA
NESTYIQMGQVHRLENEGKIDLVMIEVQVGEYTGEDDIVRIEDVYGR
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgattaatattatcttgtgtggtggatctggaacacggttgtggccactaagtagaaca
atgttacctaagcaatttgttcgtctgtttgatggttattctctttttcaggatacggtc
attcgaaatcaatctgtttgccgccattcttttgtgatctccaatactgaacagtatttt
ttggccgttgatcaattaagtcaagtttcatcgcagccttctcgtttcttgcttgaacca
gtgggaaggaatacagcgccggcaatagctttggcctgcttagctttagatgaagatgat
ttggtatttgtcaccacttctgatcatttggttaaggaccagggtgcatatgaaaatgcc
gtgattaaagcaaaaagtttagctgagcaaggaaatttagtaacttttggtattcaacct
acataccctgaaacagggtttggttatattgaagcttctggtaatgatgttctttcattt
aaagaaaaaccgagcgccaagttagctcgttcatatcttgaggcaggcaattattattgg
aattctggtatgttttgctttaaagccggtgtttttctagctgaactgcaaaagcattct
ccagaaatttatgaggcatcgttacgggccatgcggtctgtcaaagaggaatgtgcttca
caggatgacaaggtcatcaaaattgatttggatgctatgcagtccattcctgaagacagt
attgactatgcagtgatggaaaagtcggatatcgttaaagtcgttccttgtgatatgggg
tggtcggatttgggtagctttgatgctttgtatgatgaggtaaaagacgactcgaatgaa
aacgcagtattgtctagattggataagtcacctctgcctatttgtattgattcgaaaaat
aatcttttggtgacgagagatcgtcagttggcattggttgatgtagaagatttgttggtt
gttgatacttcggatgcgatactaatttccaaaaagggtagttctcaaaaggtcaaacaa
gtcgtatccatgatcaagaagcaatctcccgagttggctgaaattcatcgcttagctcat
cgtccatggggaacttatgaggtattgattgattctgagcagtataaggttaaaagaatt
gttgtgaagcccggaagtaaactctcgcttcaaaaacactttcatcgtaatgaacattgg
attgtcgtttcaggaactgcaagcgtaacggttgataaagaaacctttcttgtgcgagca
aatgaatccacctatattcagatgggccaggttcaccgcttggaaaatgaaggaaagatc
gatttggttatgattgaagttcaagttggtgagtatactggtgaggatgatattgtcaga
attgaggacgtatatggacgataa

DBGET integrated database retrieval system