KEGG   Thiomicrospira cyclica: Thicy_0019Help
Entry
Thicy_0019        CDS       T01517                                 

Definition
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00030  Pentose phosphate pathway
tcy01100  Metabolic pathways
tcy01120  Microbial metabolism in diverse environments
tcy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Thicy_0019
Enzymes [BR:tcy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Thicy_0019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR PALP Epimerase NmrA 2-Hacid_dh_C GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: AEG30795
UniProt: F6DB55
Position
18492..19289
Genome map
AA seq 265 aa AA seqDB search
MNQTRYPELAGKRVWITGSSSGIGAGMAKILAQQGCKLVLHYCRNETGVQQTLQTVAELG
AEVEVVWGDFADYASLENVFHQAWSAFDGLDVLINNAGIVTKSTALNDNTGAAFNRTIAI
NLQAPYRLSTAFAKACIDAKQPGVIINNSSIHGQQTCEWFSAYAASKAGLDAMMKVMAVE
WGPKGIRVNSLAPGVVPVERTAKILAEPKMAATWTKTMPLQRFGHVDDMGWATAFLISDS
AAWMTGSVLTVDGGLIARGGYPARE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaacacgatacccagagctcgcaggtaagcgggtatggataactggttcgtcc
agtggcattggtgccggaatggcgaaaatactggcacaacaagggtgtaagctggtgttg
cactactgccgaaatgaaaccggcgtacagcaaaccttacaaactgtggcggaattgggc
gccgaggtggaagtggtgtggggtgattttgctgactatgccagtttagaaaacgtattt
caccaggcctggtcggcgtttgatggcttggatgtattaattaataacgctggtattgtt
acgaaatccaccgcattaaatgataacaccggcgcggcctttaaccgcacgatagcgatt
aacttacaagccccttatcgattgagtaccgcgtttgccaaagcctgtatcgacgccaag
caaccgggcgtaattattaataactccagtattcatggtcagcaaacctgtgagtggttt
agtgcctatgccgcctcaaaagccggtttggatgcgatgatgaaagttatggcggttgag
tgggggccaaagggtattcgagtcaatagtttggcgccgggggtggtgccagttgaacgt
actgcgaaaattttagccgaacctaaaatggccgctacctggaccaaaactatgccgctg
cagcgttttggtcatgttgatgatatgggttgggcgacggcatttttaatcagcgattcg
gcggcttggatgaccggttcggtattaacggtcgatggtggtttaattgccagaggcggc
tacccagctcgagagtga

DBGET integrated database retrieval system