KEGG   Thiomicrospira cyclica: Thicy_0079Help
Entry
Thicy_0079        CDS       T01517                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00010  Glycolysis / Gluconeogenesis
tcy01100  Metabolic pathways
tcy01110  Biosynthesis of secondary metabolites
tcy01120  Microbial metabolism in diverse environments
tcy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thicy_0079
Enzymes [BR:tcy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Thicy_0079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEG30855
UniProt: F6D924
Position
83082..83990
Genome map
AA seq 302 aa AA seqDB search
MLDQLQQRFDHPNVRFYQRDQLVMIELNNRYGQATVTTHGATLLSYIPAGGSDLLWVSDT
AIYDGSKPVRGGVPVCWPWFGAYDASKMGADPTDAVKKAHGFARYELWEVESVESIGDAT
QVVLSLTPNASIEKAWSHDFKLSLAITLGKQLTVELIGENRSDQAWYVTEALHTYFKVAQ
APGLVVEGLEGITYYDKNQDFAPFTQTDRLKVQAPMDCVYVDHIGAVVIKDQGRDIKMDK
SNSASTIVWNPGAEGVKAFADMPDGQYQHMVCIEAGNALQNGYELAAGARHVMTMTLEEV
AR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaccaattacaacagcgttttgatcaccccaatgtgcgtttttatcagcgcgac
cagttggtaatgattgagctaaacaatcgttacggccaagccacagtgacgactcatggg
gcgaccctgctaagttacatccctgcaggtggcagcgatctattatgggtgagcgatacc
gcgatttatgacggcagtaagccagtgcgcggtggggtgccggtgtgttggccgtggttt
ggtgcttatgatgctagcaaaatgggcgcagacccaaccgatgccgtcaaaaaagcgcac
ggttttgcacgttatgaattgtgggaggttgaatcggtcgaatcaatcggtgatgctacc
caagtggtattaagcctaaccccaaatgcgtcgattgaaaaagcctggtcacacgatttt
aaactcagcctagccattaccctcgggaagcaattaacggtcgagctgattggcgaaaac
cgcagtgaccaggcctggtatgtcaccgaagccttgcacacctactttaaagttgcccaa
gcgccaggcctggtagttgaaggtttggaaggcatcacttattatgataaaaaccaagat
tttgctccctttactcaaaccgataggctaaaggtgcaagcaccgatggactgcgtctat
gtcgatcacatcggtgcagtcgtcatcaaagatcaagggcgtgatattaaaatggataag
agcaacagcgccagcaccatcgtttggaacccgggtgcggaaggtgttaaagcctttgcc
gatatgccagatggtcaatatcaacatatggtgtgtatcgaggcgggtaacgcgttacag
aatggttatgaattggccgctggcgctcgtcatgtcatgacaatgaccttggaggaggta
gcaagatga

DBGET integrated database retrieval system