KEGG   Thiomicrospira cyclica: Thicy_0357Help
Entry
Thicy_0357        CDS       T01517                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00010  Glycolysis / Gluconeogenesis
tcy00030  Pentose phosphate pathway
tcy00051  Fructose and mannose metabolism
tcy00052  Galactose metabolism
tcy00680  Methane metabolism
tcy01100  Metabolic pathways
tcy01110  Biosynthesis of secondary metabolites
tcy01120  Microbial metabolism in diverse environments
tcy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thicy_0357
   00030 Pentose phosphate pathway
    Thicy_0357
   00051 Fructose and mannose metabolism
    Thicy_0357
   00052 Galactose metabolism
    Thicy_0357
  Energy metabolism
   00680 Methane metabolism
    Thicy_0357
Enzymes [BR:tcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Thicy_0357
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Thicy_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEG31133
UniProt: F6DAP0
Position
complement(496834..498096)
Genome map
AA seq 420 aa AA seqDB search
MHNALYAQAGGVTAVINVSAAGVIETLRQYNTPRIYAAINGIQGLLDEELVDLTQINDAE
LERLKCLPGGAFQACRFDLDTLEKRPDQYERLLQIFSYYDIGTFFYNGGNGSMLTAQKVA
DYCQSKGYPLRCIGVAKTIDNDLAMSYCSPGFGSAAKFLASHFLQATLDIQSMSASSTKF
FVMEAMGRNVGWLALSAGLVKDVIADLPLIILPAERAFNEQRFLHKVSQLIDKHGYCVCM
ASEGLCDTEGQCLSVAREEHAHGKVYRQFGGVAQKLAQLVEQALQVKTHSANPDYLQRSS
ALCVSATDWQMAYEAGAAAVHAAQQGEHGVLPIIEKVQDQPFTWRFKSYPLADVAELELR
VPDDYISDDGMDITDAGLAYLRPLVMGERPMIWRQGLPALQPLNWKRIAKSLPSFATDKN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcacaatgccctttacgcccaagccggtggcgtgactgccgtcataaatgtcagcgcg
gcgggcgttatcgaaaccttacgccaatacaatacgccacgcatctatgcggcgatcaat
ggcattcaaggtttattagatgaagagttggtcgatttaactcaaataaacgatgccgaa
ctagaacgtcttaagtgtctacctggcggtgcatttcaagcctgtcgctttgatttggat
acgctagaaaaacgtcccgatcaatacgaacgcctactgcaaatttttagctattacgat
attggcacatttttttacaacggcggcaatggatccatgctgaccgcacaaaaagtcgct
gactattgccagtcgaaaggttatccacttcgctgtattggcgtagcaaaaactatagat
aacgatctagccatgagctactgcagccccggctttggcagtgccgccaaattccttgcc
agtcactttctacaagcaacgctagacatccaatcgatgtcagccagctcaactaagttt
tttgttatggaagcaatggggcgcaatgtgggctggctcgctctttcagcaggcctggtt
aaggatgttatagccgacttaccgctgattattttgcccgcagagcgtgccttcaatgaa
caacgcttcttacataaagtttctcagctaattgataagcacggctattgtgtatgcatg
gcatcagagggactttgtgataccgaggggcagtgtttgtctgttgctcgcgaagaacat
gcgcacgggaaagtttatcgccaatttggtggtgttgcccaaaagctcgcccagctagtg
gaacaagctcttcaggtaaaaacacacagtgcgaacccagactacttacagcgttcttcg
gcattatgtgtatctgcgacagattggcaaatggcttacgaggctggtgcggcagctgtt
cacgccgcacaacaaggcgagcacggcgtattaccgattatcgaaaaagtacaagatcag
ccgtttacttggcgctttaaaagctatccactggccgatgtcgctgaattagaattacgc
gtacctgatgactatattagcgacgatggcatggatataaccgatgctggcttggcttat
ttaagaccgcttgttatgggcgaacggcccatgatatggcgccaaggattgccggccctt
caaccactcaactggaaacgcatcgccaagtccctgcccagctttgcaacggataaaaat
tag

DBGET integrated database retrieval system