KEGG   Thiomicrospira cyclica: Thicy_0588Help
Entry
Thicy_0588        CDS       T01517                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00450  Selenocompound metabolism
tcy00970  Aminoacyl-tRNA biosynthesis
tcy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Thicy_0588
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thicy_0588
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tcy01007]
    Thicy_0588
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tcy03016]
    Thicy_0588
Enzymes [BR:tcy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Thicy_0588
Amino acid related enzymes [BR:tcy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Thicy_0588
Transfer RNA biogenesis [BR:tcy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Thicy_0588
 Prokaryotic type
   Other AARSs
    Thicy_0588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1e tRNA-synt_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AEG31360
UniProt: F6DBX4
Position
complement(727772..729820)
Genome map
AA seq 682 aa AA seqDB search
MSQVRKILITSALPYANGPIHLGHLVEYIQTDIWSRFQKQRGNNCIYVCADDAHGTPIML
RAQSEGISPEQLIARVSEEHQRDFAGFHINFDQYHSTHSDENRHYSSYIYNQLKANNHIS
RKTIKQAFDPEKNMFLPDRFIKGTCPKCGADDQYGDNCEVCGATYSPTELKNPKSVVSGA
TPIEKDSEHLFFELGHFEPMLKDWTQGGHLQTQISNKLNEWFESGLQKWDISRDAPYFGF
EIPGEENKFFYVWLDAPIGYLASFKKYCDQHGINFDDYWAKDSDAELYHFIGKDIVYFHA
LFFPAMLAGAGFRTPSAIFAHGFLTVDGAKMSKSRGTFIMASTYLKHLNPEYLRYYFATK
LNSRIDDLDLNLDDFVQRVNSDLIGKVVNIASRCAGFVSKRFDGKLNQAWSAEAEALFQQ
FAEQSDAIAQLYEKREYAQAMRDIMALADKANEYIADTAPWVLAKEDGKKAELHESVSLG
LNLFRVLMIYLAPVLPETAGKAREFFNEDAWNWTSANTPLKGHSIQAYQALLTRLDMTQV
EKMLDDSKQTLQATPTIPAQMTAPMTETKFDPVAPEISIEDFAKIDFRIAKIVNAEAVPE
ANKLLKLTLNIGLGERQVFAGIKSAYEPEQLIGKLTVMVANLAPRKMRFGMSEGMVLAAG
PGGKDLFILNPDDGAQPGMRVK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggtcagaaaaattttaattaccagtgcgctcccctatgccaatggccctatt
cacttaggtcatttggtggaatatatccaaacagacatctggtcacgctttcaaaaacaa
cgtggaaacaactgtatttatgtttgtgccgatgatgcccatggaaccccgattatgctg
cgtgcccaatccgaaggtattagcccagaacagcttattgcgcgcgtgtccgaagaacac
caacgtgacttcgccggttttcatattaattttgaccaataccacagcacccattcagac
gaaaaccgtcattattccagctatatctacaatcagctgaaagccaacaatcacattagc
cgcaaaaccattaagcaagctttcgacccggaaaaaaacatgtttttgcccgaccgcttt
atcaaaggtacctgcccgaaatgtggtgcggacgaccaatacggcgataactgcgaagtc
tgtggtgcgacatatagcccaaccgagctgaaaaacccgaaatccgtggtatcaggcgcg
acaccgattgaaaaagacagcgaacacctgttttttgaactcggccattttgagccgatg
cttaaagactggacccaaggcggtcatttgcaaacccaaatttccaacaagctcaatgaa
tggtttgagtccggcttacaaaaatgggacatcagccgtgatgcgccctactttggtttt
gaaattcccggtgaagagaataaattcttctatgtgtggttggatgccccgattggttat
ttggcgtcatttaaaaaatattgcgaccagcacggcatcaactttgatgactactgggca
aaagattcagacgctgagctgtatcattttatcggcaaggacatcgtgtatttccatgca
ctattcttcccagcgatgctagccggtgcgggctttagaacgccttcggcgattttcgcg
catggttttttgaccgtcgatggcgccaagatgtccaagtcgcgcggcacttttattatg
gccagcacctatttaaaacacttaaacccagagtacctgcgttattacttcgccaccaaa
ctcaatagccgtattgatgacctcgatttaaatctggatgactttgtgcagcgagtaaat
tccgatttaattggcaaggtcgtcaatattgccagccgttgtgccggttttgttagtaaa
cgctttgatggcaagcttaaccaggcctggtcagccgaagccgaggcgttattccagcag
tttgccgagcaaagtgacgcgattgcccaactctatgaaaaacgcgaatacgctcaggcg
atgcgggacattatggcgttggccgataaagccaatgaatacattgccgacacggcccct
tgggtgcttgcgaaagaggacggcaagaaagccgaactccacgagtcggtgagtttgggc
ttaaacctgttccgcgtcctgatgatttatttagctccagtgctacccgaaacggctggc
aaagcccgcgaattctttaacgaggatgcctggaattggacatctgcgaatacaccatta
aaaggtcattccatccaagcttaccaagccctattgacgcgtttagatatgacacaggta
gaaaaaatgttagacgactccaaacaaactttacaagccactccaacgataccagcacaa
atgacagcgccaatgactgaaaccaaatttgacccggttgcccctgaaatcagcattgaa
gactttgctaaaattgatttccgtatcgctaaaatcgtcaatgccgaagcagtgcctgaa
gccaataaactgctaaaactgacactcaacattggcttaggtgaacgccaggtgtttgct
gggattaaatccgcctatgaaccggagcaactgattggtaaactcactgttatggtagct
aaccttgcgccgcgtaaaatgcgctttggcatgtctgaaggtatggtacttgctgctggc
ccaggcggtaaagatttattcattctcaatccggatgacggtgcacaacccggcatgcgc
gttaaataa

DBGET integrated database retrieval system