KEGG   Thiomicrospira cyclica: Thicy_0635Help
Entry
Thicy_0635        CDS       T01517                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00010  Glycolysis / Gluconeogenesis
tcy00051  Fructose and mannose metabolism
tcy00562  Inositol phosphate metabolism
tcy00710  Carbon fixation in photosynthetic organisms
tcy01100  Metabolic pathways
tcy01110  Biosynthesis of secondary metabolites
tcy01120  Microbial metabolism in diverse environments
tcy01130  Biosynthesis of antibiotics
tcy01200  Carbon metabolism
tcy01230  Biosynthesis of amino acids
Module
tcy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thicy_0635
   00051 Fructose and mannose metabolism
    Thicy_0635
   00562 Inositol phosphate metabolism
    Thicy_0635
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Thicy_0635
Enzymes [BR:tcy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thicy_0635
Exosome [BR:tcy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thicy_0635
  Exosomal proteins of bladder cancer cells
   Thicy_0635
  Exosomal proteins of melanoma cells
   Thicy_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEG31407
UniProt: F6DC21
Position
780252..781022
Genome map
AA seq 256 aa AA seqDB search
MRIPFVAGNWKMHGSKAMIQDHLGQFTQQAEALNNVNIAVCPPSLYVSAVQSQLTSSSVK
VGVQNVCDQAGFGAYTGEVSVDMLVDMGVPYAIVGHSERRAFYCETDRQVADKVAIVLDK
NLTPILCIGETLEERESDQTEHVVKTQLIAVIEKVGIAAFANIVIAYEPIWAIGTGKTAS
PEQAQAVHAFIRNLLAQHDTAVAQQVVIQYGGSVKPDNAAALFAQPDIDGGLIGGASLDP
MDFLAICKAASQSCLK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgagaatcccatttgttgcaggaaattggaagatgcatggctccaaagctatgattcaa
gaccacttggggcagtttacacagcaagctgaggcgttgaataatgtaaatatagcggtt
tgtcccccaagtctatatgtaagtgctgtacaatcacagctcacttcaagtagtgtaaaa
gttggtgtgcaaaatgtatgcgatcaagcaggttttggcgcctacactggtgaagtgtct
gttgatatgcttgttgatatgggtgtgccctatgcgattgttggtcactcagaacgtcgt
gcgttttattgcgaaaccgatcgtcaggtagccgacaaggttgcgattgtgctcgataaa
aacctaacacctattttatgtattggtgaaactctagaagagcgcgaaagcgaccaaaca
gaacatgtggttaaaacacagcttatagctgttattgaaaaggttggtattgcagcattt
gctaatattgtaattgcctatgagcctatttgggcgattggtaccggtaagacagcaagc
cctgagcaagcccaagcggtacatgcgtttatacgtaaccttcttgcacaacatgataca
gcagttgcacagcaggtagtgattcagtatggcggtagtgtaaaaccggataatgccgct
gctttgtttgctcaacccgatattgatggtgggttaattggcggtgcgtcacttgatccg
atggattttttagcaatttgtaaggcggcttcgcaatcatgtttgaaatag

DBGET integrated database retrieval system