KEGG   Thiomicrospira cyclica: Thicy_0652Help
Entry
Thicy_0652        CDS       T01517                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00010  Glycolysis / Gluconeogenesis
tcy00030  Pentose phosphate pathway
tcy00051  Fructose and mannose metabolism
tcy00052  Galactose metabolism
tcy00230  Purine metabolism
tcy00500  Starch and sucrose metabolism
tcy00520  Amino sugar and nucleotide sugar metabolism
tcy00521  Streptomycin biosynthesis
tcy01100  Metabolic pathways
tcy01110  Biosynthesis of secondary metabolites
tcy01120  Microbial metabolism in diverse environments
tcy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thicy_0652
   00030 Pentose phosphate pathway
    Thicy_0652
   00051 Fructose and mannose metabolism
    Thicy_0652
   00052 Galactose metabolism
    Thicy_0652
   00500 Starch and sucrose metabolism
    Thicy_0652
   00520 Amino sugar and nucleotide sugar metabolism
    Thicy_0652
  Nucleotide metabolism
   00230 Purine metabolism
    Thicy_0652
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thicy_0652
Enzymes [BR:tcy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Thicy_0652
    5.4.2.8  phosphomannomutase
     Thicy_0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AEG31424
UniProt: F6DC38
Position
796469..797824
Genome map
AA seq 451 aa AA seqDB search
MNNLSAFKAYDIRGKVPEEVNETLAYKLGRVFIDELQAKRVVLGYDIRLESKGLADALVR
GFTDAGADVLCLGLCGTEEVYFNTADLDADGGIMVTASHNPKGYNGMKLVSKDAQPISRD
SGLNRFAERILADELGGLAAKPGLLTPCLSKERYINHLMGYVDVASLKPTKVVLDCGNGA
AGAVIKQIAAHLPFECVFVNDNPDGNFPNGVPNPLLPTMRDLTAQAVREHHADLGIAWDG
DFDRCFLFDETGEFVEGYYLVGLLAETLLAKYPGGKIIYDPRLTWNTIEQVTQAGGVPIQ
SKTGHAFIKERMRLEDAVYGGEMSAHHYFKDFFYCDSGMIPWLLITQLMSVSGKPLSALV
AERVAAYPCSGELNYTVADVPSVLARVQAHFADLNTLQDNTDGLGLDFGDWRLNIRTSNT
EPLLRLNVESRGDRNLVWQKVAEIEDLIDNR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaacttatctgcctttaaagcctatgatattcgaggcaaggtacctgaagaggta
aacgaaacgttggcgtataaactcggccgagtgtttattgatgaattacaggccaagcgg
gtagtgttaggttatgacatccgtttagagagtaaaggtttagccgatgctttggttcgt
ggatttacagacgccggcgctgatgtgctgtgtttgggcttgtgcggcaccgaggaagtt
tattttaataccgcggatttagacgccgatggcggcattatggtgacggcgagtcataat
ccgaaaggctataacggcatgaagttggtgtctaaagacgcacagccgatttcccgtgat
tcgggtttaaaccgctttgccgagcggattttggcggatgagttgggaggtttggcagca
aaaccaggactgctcacaccttgcttgagtaaggagcgctacataaaccatttaatgggt
tatgttgatgttgccagcttaaagccgacaaaagtggtgctggattgtggcaatggtgcc
gcgggtgccgtcatcaaacagattgccgctcacttgccgtttgagtgtgtgtttgtaaac
gataacccagatggaaattttcctaatggcgtgcccaatccgctattaccgactatgcgt
gatcttaccgcgcaagcggtgcgcgagcatcatgccgatcttggcattgcttgggatggt
gactttgatcgttgttttttatttgatgagaccggtgaatttgttgagggttactatttg
gttggcttgttagccgaaaccttgttggctaaataccctggaggcaagattatttatgat
ccgcgcttaacttggaacacgattgaacaggttacacaagctggcggggtgccgattcag
tctaaaactgggcatgcgtttattaaagagcggatgcgtttagaagatgcggtgtatggg
ggcgaaatgtcggcacatcattactttaaagactttttttattgcgattcggggatgatt
ccgtggttgctgattacccagttgatgtcggtgtcgggcaaacccttaagtgcgttagtg
gccgagcgtgttgctgcttatccttgcagtggtgagttaaattacaccgttgccgatgtg
ccgagtgtattagctcgagtacaggcgcattttgctgacctaaacacgttgcaggataat
accgatggcttagggcttgattttggagattggcggttaaatattcgcacctcgaacacc
gagcctctcttgcgtttaaatgttgaaagccgtggtgaccgcaacttggtgtggcaaaaa
gttgcggaaattgaagatttaattgataacaggtaa

DBGET integrated database retrieval system