KEGG   Thiomicrospira cyclica: Thicy_0684Help
Entry
Thicy_0684        CDS       T01517                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tcy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thicy_0684
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tcy01007]
    Thicy_0684
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tcy03016]
    Thicy_0684
Enzymes [BR:tcy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     Thicy_0684
Amino acid related enzymes [BR:tcy01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Thicy_0684
Transfer RNA biogenesis [BR:tcy03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Thicy_0684
 Prokaryotic Type
    Thicy_0684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 DUF4473 ApoLp-III tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AEG31456
UniProt: F6DC70
Position
830791..832167
Genome map
AA seq 458 aa AA seqDB search
MALHIYNTETRQKEVFKPIVPGKVGMYVCGVTVYDYCHIGHARVMVVFDTVVRHMRARGL
EVKYVRNITDIDDKIIKRALENQESVQSLTERFITAMHEDETALNILRPDIEPKATDFIP
EIQQLVNTLIEKGHAYAATNGDVYFKVKSFESYGRLSGKKQDELEAGARVEVNPNKQDPM
DFVLWKASKANEPAWDSAWGQGRPGWHIECSAMSGSCIGERLDIHGGGMDLQFPHHENEI
AQSECAHGEHYVNTWMHVGFVRVDNEKMSKSLNNFFTIREVLKDYHPEVIRYFLLSSHYR
SPLNYTIENLDIAKTNLARLYTALEAATIQPGLVAVGTEFEAKFNDAMDDDFNTPQAMAV
LFELVKEVNKTQQPELVGLLQSLANRLGLLTETPEFFFKSQVGQPDGLSDEAIEALIVER
TQARADKNWARSDEIRDDLLAKGVELLDSKEGTSWRRA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggctttacacatatacaacaccgaaacgcgtcagaaagaagtctttaaacccattgtg
cccggcaaggttggtatgtatgtttgcggagtaacggtgtacgactattgtcatatcggt
catgcgcgggtgatggttgtgtttgatacggtggtgcgtcatatgcgcgcacgaggactt
gaggttaagtatgtgcgcaatatcaccgatattgacgataagattattaaacgcgcactc
gaaaaccaagaatcggtgcaaagcttaaccgaacgttttatcaccgccatgcatgaagat
gaaaccgcgttgaatattttgcgcccagacattgagccaaaagcgaccgactttatccct
gaaattcagcagttggttaacaccctaattgaaaaggggcatgcctatgccgcaacgaat
ggtgatgtgtattttaaagtgaagtcctttgaatcctatggccgtttgtcgggtaaaaag
caagacgaactggaagccggcgcacgggtagaggtgaatcctaataagcaggatcccatg
gattttgtactatggaaagcctccaaagcaaacgaacccgcttgggattcggcttggggg
caaggcaggcctggttggcatattgaatgttcggccatgtccggctcgtgtatcggtgaa
cgtttggatattcatggtggcgggatggatttgcagtttcctcaccatgaaaacgaaatc
gcgcaatcggaatgtgcgcatggcgagcattatgttaatacctggatgcatgtcggcttt
gtgcgtgttgataacgaaaaaatgtccaagtcgctgaataactttttcacgattcgtgaa
gtgctaaaagactatcacccagaagtgattcgttatttcttgttatcgagtcattatcgc
agcccgttgaactacacgattgaaaaccttgatattgctaaaaccaatttagcgcgttta
tacaccgcattagaagcagcgacaatccaaccaggcctggtagcggtaggcactgagttt
gaagcaaagtttaatgacgcgatggatgatgatttcaacaccccgcaagcaatggcggta
ttgtttgaattggttaaagaggtcaataaaacgcaacaacccgagctggtgggtttgtta
caaagtctggcgaatcgtttaggcttattaacagaaacccctgagtttttctttaaaagc
caggttggtcagccggatgggttaagcgatgaagcgattgaggcattaattgtcgagcgc
acgcaggcacgtgcggataaaaactgggcgcgttccgatgagattcgtgatgacttgttg
gcaaaaggggtcgagttgctggacagtaaagaaggcaccagttggcgtagagcctaa

DBGET integrated database retrieval system