KEGG   Thiomicrospira cyclica: Thicy_0715Help
Entry
Thicy_0715        CDS       T01517                                 

Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tcy  Thiomicrospira cyclica
Brite
Enzymes [BR:tcy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Thicy_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 RrnaAD
Motif
Other DBs
NCBI-ProteinID: AEG31487
UniProt: F6DCA1
Position
863995..864708
Genome map
AA seq 237 aa AA seqDB search
MSILNEPLLYPNGYYQHYQGLGLTSQRRRDQMIARLVAQSHLRLESEVLRAMRHTPRHLF
VDEALAQRVYEDCSLPIGYGQTLSHPRTVAVMTSWLNRDGFLKDQKILEIGTGSGYQTAI
LAWFSQHIYSLERIEPLQSLAKQRLLALGYEQIRFALADGELGWSLYSPYPAILCAASAP
KIPTSLIEQLAPGGRLVLPVGVQEQRLIGIEKDLVGQSTETDLGVAQFVPLLSGLYE
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagcattttaaatgaacctttgctttaccctaatggttattaccagcattatcagggt
ttgggtttaacctctcagcgtcgtcgcgatcaaatgattgcgcgtttggtcgcgcagtcg
catctgcgtttagagagcgaggttctcagagccatgcgtcacaccccaaggcacctattt
gtagatgaggcgttagcgcagcgggtgtatgaagattgttcactgccgattggctatgga
caaacgctatcacatcccagaacagtggctgtaatgacctcctggttaaatcgtgatggt
tttttaaaggatcaaaaaattcttgaaattggtaccgggtcaggctatcaaaccgctatt
ttggcgtggttttctcagcatatttattctttggagagaattgaacccttgcaatctttg
gccaaacagcggcttttggcattaggttatgaacagattcgttttgccttagctgatgga
gaattaggttggtcattgtattctccctatccggctattttatgtgcggcatcggctcca
aaaatccccacatccttaatagaacagttggcacctgggggtcgactggtattgcctgtt
ggtgttcaggaacagcgcttaataggtattgaaaaggatttggtagggcaaagtaccgaa
acagatctgggtgttgctcagtttgttccattgttatcaggactctatgaatga

DBGET integrated database retrieval system