KEGG   Thiomicrospira cyclica: Thicy_0754Help
Entry
Thicy_0754        CDS       T01517                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00030  Pentose phosphate pathway
tcy00480  Glutathione metabolism
tcy01100  Metabolic pathways
tcy01110  Biosynthesis of secondary metabolites
tcy01120  Microbial metabolism in diverse environments
tcy01130  Biosynthesis of antibiotics
tcy01200  Carbon metabolism
Module
tcy_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:tcy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Thicy_0754
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Thicy_0754
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tcy04147]
    Thicy_0754
Enzymes [BR:tcy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Thicy_0754
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Thicy_0754
Exosome [BR:tcy04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Thicy_0754
  Exosomal proteins of colorectal cancer cells
   Thicy_0754
  Exosomal proteins of bladder cancer cells
   Thicy_0754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N Proton_antipo_C
Motif
Other DBs
NCBI-ProteinID: AEG31526
UniProt: F6DCE0
Position
904023..905522
Genome map
AA seq 499 aa AA seqDB search
MPVSCTYVIFGATGNLSLTKLFPAFYHLEVLGRLDPGVKIVALGRRDWQRNDWIEQARQA
VLPLARKGLDNAVFERFSARLDYIKVEINEPQSFCEMAAYFEQHDYPKNMAFYLSISPKD
FSPVVQHLSKAQLLDERDGWRRVVLEKPFGYDLESAKSLQTQLNRWLDEKQMYRIDHYLG
KGMVQNLMVFRFANLLMEPLWNRNYIDHVQITHAEAKPIGTRAGYYDGSGALRDMIQSHL
LQLLAIIAMEPPASMEAEDLRNEKVKLLKSIRPIAKSAVNAQAYRAQYSAGKVSGKAMPA
YLEEPGVATDSVTETYAALKLYIENWRWAGVPFYVQTGKNMPKNQTIISICFKQPPKQFF
RESQVKKMAPNWLVFGIQPEETIRIEMMAKQPGLEINTRQVSLDASMRQEDEEQHDAYEE
LLLDVIKGDRSLFLRFDEVKAAWKVVEPVLQAWSSDRGYIDTYPSGTWGPRDAIKLFDQP
GQHWRVSLEPEGADNDESR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtttcttgtacctatgttatttttggtgctaccggtaatttatctctcaccaaa
ttatttccggctttttatcatttagaagtgctaggtcgcttagacccaggagttaagatt
gtggcattgggtcgccgcgattggcaacgtaatgattggattgaacaggctcggcaagcg
gtattgcctttagcacgaaaaggcttagataatgccgtttttgagcgttttagcgcgcgt
ttagactatattaaagttgaaattaatgagccgcaatcgttttgtgaaatggctgcctat
ttcgaacagcatgactatccaaaaaacatggctttttacttgtctattagtccgaaagat
tttagtccggtagtgcagcatttgtccaaagcacagttgctcgatgagcgcgatggttgg
cgtcgagtggtattagaaaaaccctttggctatgatctcgaaagtgctaaaagtttacaa
actcagctaaatcgttggttagatgaaaaacaaatgtatcgtattgaccattatctaggt
aagggtatggtacagaacctgatggtgtttcgctttgctaacttgttgatggagccgctc
tggaaccgcaactatattgatcatgtgcaaattactcatgcggaagccaaaccgataggt
acccgagctggctattatgatggcagtggtgcgttgcgcgatatgattcagagtcattta
ttacaattactggcgattattgcgatggagccgccggcttcaatggaagcggaagactta
cgtaatgaaaaggttaaactgctgaaatcgattcgccccatcgccaagtcggcggtgaat
gcccaagcctatcgtgcgcaatattcagcaggtaaggtgagtggaaaggcgatgccggct
tatttagaagagcccggtgtcgcaaccgatagcgtgaccgaaacctatgcggcattaaaa
ctttatattgaaaactggcgctgggcgggcgtgccattttatgtgcaaaccggtaaaaat
atgcccaagaaccaaaccattatttcgatttgttttaaacaacccccaaagcagtttttc
cgtgaatctcaagtgaaaaaaatggcgcctaactggttggtgtttgggattcaaccagaa
gaaactattcggattgaaatgatggccaaacaacctgggttagagattaatacccgacaa
gtctcgcttgatgccagtatgcgtcaagaggatgaagaacaacatgatgcttatgaagaa
ctgttgctggatgtgattaagggcgatcgctcgttgtttttgcgttttgatgaggttaaa
gcggcatggaaggtggtcgaaccggtgttgcaggcctggtcatccgatcgcggttatatt
gatacctatccgtcgggcacctggggtcctcgcgatgcgattaaactgtttgaccagccg
gggcagcattggcgagtgagtttagagccagagggggcggataatgacgagtcccgctga

DBGET integrated database retrieval system