KEGG   Thiomicrospira cyclica: Thicy_0872Help
Entry
Thicy_0872        CDS       T01517                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00010  Glycolysis / Gluconeogenesis
tcy00620  Pyruvate metabolism
tcy00640  Propanoate metabolism
tcy00680  Methane metabolism
tcy01100  Metabolic pathways
tcy01110  Biosynthesis of secondary metabolites
tcy01120  Microbial metabolism in diverse environments
tcy01130  Biosynthesis of antibiotics
tcy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tcy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thicy_0872
   00620 Pyruvate metabolism
    Thicy_0872
   00640 Propanoate metabolism
    Thicy_0872
  Energy metabolism
   00680 Methane metabolism
    Thicy_0872
Enzymes [BR:tcy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Thicy_0872
Lipid biosynthesis proteins [BR:tcy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Thicy_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEG31644
UniProt: F6DCQ8
Position
complement(1028677..1030632)
Genome map
AA seq 651 aa AA seqDB search
MSNNIESILTETRVFEPSDAIKQQAAIKADKLDAMYAKAEQDHVGFWADLAKEKLSWHKP
FTKALDDSKAPLYRWFTDGELNVSYNCIDRHLDTKSDKLAIIFEGDKGDVHHYTYQELHD
EVCRFANTLKTQGIKQGDRVIIYMPMIPQAVIAMQACARVGAIHSVVFGGFSAEALKDRV
ENAAAKLIITTDGGLRGGKAIPLKGAVDQALAKGCDSVKKVIVYQRTKQEVVMQDGRDIW
WHEAEAGMSNYHDPVMLPADHPLFLLYTSGSTGTPKGVQHGSGGYLLNAMLTNEWMFDLN
DKDVFWCTADVGWITGHSYVAYGPLAMGATIVMFEGVPTYPDAGRFWQVCQDHGVTVFYT
APTAIRALMKFGKDIPAQYDLSKLRILGTVGEPINPEAWMWYHEVIGRGECPIIDTWWQT
ETGAHMIAPFPGVTPLKPGSCTRPLPGIDAIVVDEEGHEIGNNSGGYLVVRKPWPSMLQT
VWGDDQRYIDTYFAKFNNQYYVVGDSAHKDADGYIWILGRIDDVLNVSGHRLGTMEIESA
LVAHPKVAEAAVVGKPHDVKGESVFAFVVLNTDLPAGAERDAMVNELRNWVAQEIGPIAK
PDDIRFGTNLPKTRSGKIMRRLLRTIAKGEEITQDTSTLEDPSILKQLQQA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacaatatcgagtcaattttgacagaaacacgggtctttgaaccctcagatgcc
attaaacaacaggctgctattaaggcagataaacttgatgccatgtatgctaaagccgag
caggatcatgtgggtttttgggccgatttagccaaggaaaagttgagctggcacaagccg
tttaccaaagcattggatgattccaaagcaccgctttatcgctggtttaccgatggtgag
ttaaatgtttcttataattgtattgaccgtcatctcgataccaaaagcgataaattggca
attatttttgaaggggataagggtgatgtgcatcactatacttatcaagaattgcacgat
gaagtctgtcgttttgccaataccttaaaaacccaaggcattaagcagggtgatcgggtc
attatttacatgccgatgattccgcaagcggtgattgcgatgcaggcctgtgctcgtgtt
ggcgcgattcattccgtagtgtttggtggcttttcagccgaggcgttaaaagatcgcgtt
gaaaatgctgcggctaaactgattattaccaccgatggtggtttgcgcggcggtaaggcg
attccgcttaaaggtgcggtggatcaggcgttagcgaaaggctgtgattcggttaaaaaa
gtgattgtttatcagcgcaccaaacaagaagtggtgatgcaagatggtcgtgatatttgg
tggcatgaagccgaagcgggcatgagtaattatcatgatccggtaatgctacccgccgat
catccgctgtttttgttatatacctctggctcaaccgggacaccgaaaggcgtacagcat
ggcagtggtggttatctgttaaacgcgatgctgacgaatgagtggatgtttgatttaaat
gacaaggatgtgttctggtgtaccgctgatgtaggctggattaccggtcactcttatgtc
gcctacggtccgttagcgatgggtgcgaccattgtgatgtttgaaggcgtgccaacctat
ccggatgccggtcgtttttggcaggtgtgtcaggatcatggtgttaccgtgttctatacc
gcaccgactgcgattcgtgctttgatgaagtttggtaaggatattccagcgcagtatgat
ctttccaagctgcgtattttaggtacggtgggcgagccgattaacccagaagcctggatg
tggtatcacgaagtgattggtcgcggtgaatgtccgatcattgatacctggtggcaaacc
gaaaccggtgcccatatgattgcgcctttcccaggtgttacaccgcttaaaccaggttct
tgtacgcgtccactacccggaattgatgcgattgtcgtcgatgaagaaggccatgagatt
ggcaataactcagggggttatttggtggtgcgcaagccgtggccatccatgttacaaacc
gtctggggtgatgatcagcgttatattgacacctattttgccaagtttaataaccaatat
tatgtggttggtgacagtgcgcataaagatgccgatggttacatctggattttaggtcgt
attgacgatgtgctaaacgtatcaggtcatcgtttaggtacgatggaaattgaatcggcg
ttggtcgctcatccaaaagtggccgaagctgcggtggtcggtaaaccccatgatgttaaa
ggcgaatcggtgtttgcttttgtagtcctcaataccgatttgccagccggtgcggagcgt
gatgcgatggttaatgaattgcgtaactgggtggctcaagaaattggcccgattgccaag
cccgacgatattcgcttcgggaccaatttacccaaaacccgttctggcaaaattatgcgt
cgtttattgcgcaccatcgccaagggtgaagaaattactcaggatacctctactttggaa
gatccgtcgattttgaaacagttgcagcaggcttag

DBGET integrated database retrieval system