KEGG   Thiomicrospira cyclica: Thicy_1232Help
Entry
Thicy_1232        CDS       T01517                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tcy  Thiomicrospira cyclica
Brite
KEGG Orthology (KO) [BR:tcy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Thicy_1232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 GtrA
Motif
Other DBs
NCBI-ProteinID: AEG31999
UniProt: F6D8Z9
Position
1408273..1409841
Genome map
AA seq 522 aa AA seqDB search
MELKNIQHLEEASQRSRKELLRFGLALLFIIGVILYTFINYGHISFTLVVAAMIGGYMAM
NIGANDVANNVGPAVGSKAMTLTTAIIIAAVFEAAGAIIAGGSVITTIKGGIIDPADVDD
TEAFIWLMMAALLAAAVWLNIATALGAPVSTTHSIIGGVMGGGIAAAGWAIVNWGTVGQI
AASWVISPMLGGLIAALLLYLIKRTITYKEDMMDASRRMVPWLLALMGWAFGTYLMMKGF
SQIMKVSFMTSALVGLAVATAVFFITRPLVNRASVAASNCKKGVNQMFTIPLIFAAALLS
FAHGSNDVANAVGPLAAIHEALTSGDVGGSKAAIPIWILVVGALGIALGLALYGPKLIKT
VGTEITDIDQMRAYCIAMAAALTVILASQLGLPVSTTHVTIGAIFGVGFLREYLKANYQR
MIRQIEEHHEGQEREIVEAFIRRFDKANLAEKGRMLQDLKTKSLDNDAHLTKKERKGLKK
AYNQELVKRSIILKVVAAWVITVPATAVLAAGIFYSISMMMA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggaactgaaaaatattcaacaccttgaagaggcgagccaacgcagccgtaaagaactg
ttgcgttttggcttagcgttactctttattattggcgtaatactatacacctttatcaac
tatggtcatattagcttcacactcgttgttgcagcgatgattggtggttatatggcgatg
aatataggtgctaatgacgtggccaataatgtaggtcccgctgttggctctaaagccatg
actttaacaaccgccattataatcgctgcggtatttgaagccgctggagcgattattgct
ggcggtagcgttattaccacgattaagggcggcattattgatccagccgatgtcgatgat
actgaagccttcatttggctgatgatggccgctttattagcagctgcagtatggctaaac
attgccaccgcacttggcgcacctgtttcaactacccattcaattattgggggggttatg
ggtgggggcattgccgcagctggctgggcaattgttaactggggcactgtcggacaaatc
gcagccagttgggtcatttcgccgatgctcggtggtttaatcgccgcgctattactctat
ttaatcaaacgaaccatcacctacaaagaagatatgatggatgcttcccgacgtatggtg
ccatggctgttagccttaatgggttgggcatttggtacctatttaatgatgaaaggtttc
agccaaattatgaaggttagcttcatgacatcggctttggtcggtttggctgtagccacg
gcggttttctttattactcgtccgctagtgaatcgcgcctcggttgcggcctccaactgc
aaaaaaggcgtcaaccaaatgttcacgatcccattaatttttgcggccgcgctgctgagt
tttgcacacggttccaacgatgtcgcaaacgcggttggtccgttagctgccattcacgaa
gccctcacctctggcgatgtaggcggttcaaaagcggccattcctatctggattctagtt
gtaggtgcgctaggtatagcattaggtttagcactctatggccccaaattgattaaaacc
gtcggtactgaaatcaccgatatcgatcaaatgcgcgcctactgtattgctatggcggca
gctttaaccgttattttagcgtcacaactagggctaccagtgagtaccacgcatgtgacc
attggcgctatttttggtgttggctttttgcgcgaatacttaaaagctaactatcagcgg
atgattcgtcaaattgaagagcaccacgaaggtcaagaacgtgaaattgttgaagccttt
atccgtcgatttgataaagctaacttagctgaaaaaggtcgcatgcttcaagatctaaaa
acaaaaagccttgataacgatgcccacctaactaaaaaggaacgtaaaggccttaagaaa
gcttataaccaagaattggttaagcgctcgatcattttgaaagtggttgcggcctgggta
attacggttcctgcgacggcagtacttgcggctggtattttttacagtattagcatgatg
atggcctag

DBGET integrated database retrieval system