KEGG   Thiomicrospira cyclica: Thicy_1249Help
Entry
Thicy_1249        CDS       T01517                                 

Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00970  Aminoacyl-tRNA biosynthesis
tcy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thicy_1249
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tcy03029]
    Thicy_1249
Enzymes [BR:tcy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Thicy_1249
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Thicy_1249
Mitochondrial biogenesis [BR:tcy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Thicy_1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEG32016
UniProt: F6D989
Position
complement(1429468..1430934)
Genome map
AA seq 488 aa AA seqDB search
MNMMSLAELNQALQSKQISSVELTEFFLARIAAHEPELNSFITTTPEQALRMAQAADQRL
AKGDAPNLCGIPMAHKDIFCTDGVLTTCGSKMLANFTAPYDAHIVSQFKALDMPVLGKTN
MDEFAMGSSNESSFFGAVKNPWSLDRVPGGSSGGSAAAVAAGLTPFATGSDTGGSIRQPA
SFCGISGLKPTYGLASRFGMIAYASSFDQAGPMAQSAQDLALTLDVMHSFDLRDSTSLDQ
PKPDYVAALAQPLAGLRIGVPTSYFGEGLDADVKKVIETAIAEYEKLGAELVAVELPNQA
HAVAAYYILAPAEASSNLSRFDGVRYGHRCEDPKDLADLYGRSRAEGFGIEVQKRIMLGA
YALSAGYYDAYYLKAQKVRRLIQQDFLSAFEQCDVIMGPVAPTPAFKLGEKSDDPLSMYL
ADLYTIPVNLAGLPAMSLPAGQVKGMPVGLHLVGPYFSEAKLLNVAHQYQLHTDWHLQRA
PMAQGAAL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgatgtccttagcggagcttaaccaggccttacaaagcaagcaaatttcgagt
gttgagcttaccgagttttttttagcgcgtatcgcagcacatgagccagagctaaacagc
tttattacgacgacccctgagcaggccttgcgcatggcacaggcggctgaccagcgttta
gcaaaaggtgatgcccccaatttatgtggtattccgatggcgcacaaagatatattttgt
accgatggcgtcttaacgacctgtggttctaaaatgttggcgaattttaccgcgccatat
gacgctcatatcgtgagtcaattcaaagccttagatatgccggtattgggtaaaacgaat
atggatgagtttgcgatgggctcatcgaatgagtcgagtttttttggcgcggttaaaaac
ccctggtcgcttgaccgtgtgccaggtggttcgtccggtggttccgccgcggctgttgct
gccgggttaacgccatttgccaccggttcggatacgggtggctcaattcgtcagccagcc
agcttttgtggtatcagtggcttgaaaccaacctatggactcgcctcacgttttggcatg
attgcctatgcctcaagttttgatcaggccggcccgatggcgcaatctgctcaagattta
gcactgactttagatgtgatgcatagttttgatttgcgtgactctaccagcttagatcaa
ccgaaacccgattatgtagccgctttggctcagcccttagcaggcctgcgtattggggtg
cctaccagctactttggtgaaggtctagatgctgacgttaaaaaagtcatcgagacggcc
attgctgagtatgaaaaactgggcgcggagctcgtggcggtcgaattgccgaatcaagca
cacgcggtggcggcctattatattttggcaccagcagaggcctcatcgaatttgtcgcgt
tttgatggggtccgttatggtcaccgttgtgaagatccgaaggatttggccgatctctat
gggcgttcacgagccgagggctttggtattgaagtacaaaaacggattatgctcggtgcc
tatgccttatcggcaggttattatgatgcctactatttgaaggcgcaaaaggtgcgtcgt
ttgattcagcaagattttttatctgcctttgagcaatgcgatgtgattatggggcctgtt
gcgcctactcccgcatttaagttgggtgaaaaaagtgatgatccgttaagtatgtatttg
gccgatttatataccattccagtgaacttagcagggctgccggcgatgtcgcttccggcc
ggtcaggttaagggtatgccggttggattgcacctagttggcccctattttagcgaagca
aaattattgaatgtggcgcaccagtatcagttacataccgattggcatctacaacgcgca
cctatggcacaaggagcagcattatga

DBGET integrated database retrieval system