KEGG   Thiomicrospira cyclica: Thicy_1250Help
Entry
Thicy_1250        CDS       T01517                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
tcy  Thiomicrospira cyclica
Pathway
tcy00970  Aminoacyl-tRNA biosynthesis
tcy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thicy_1250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tcy03029]
    Thicy_1250
Enzymes [BR:tcy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Thicy_1250
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Thicy_1250
Mitochondrial biogenesis [BR:tcy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Thicy_1250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln DUF1456
Motif
Other DBs
NCBI-ProteinID: AEG32017
UniProt: F6D990
Position
complement(1430964..1431251)
Genome map
AA seq 95 aa AA seqDB search
MALSEDDVLKIAKLAAIDVSTQDLTKLSAKLSNVLDLFAQLEQVNTDGVKPMAHPLDQVQ
RLRLDQAVEVVDCEKYQALAPACEQGLYLVPKVIE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggccttatctgaagatgatgtcttgaagattgcaaaattggcagcaattgacgtatca
acacaggacttaaccaaattgtcagccaagctctctaatgtattggatttgtttgcacaa
ctcgaacaggttaacaccgatggggtaaagcctatggctcatccgcttgatcaggtgcag
cgtttgcgattggatcaggctgttgaggtggtggattgtgaaaagtatcaggccttggca
ccagcctgtgagcaaggcttgtatcttgtgcctaaagtgattgaataa

DBGET integrated database retrieval system