KEGG   Treponema denticola: TDE2271Help
Entry
TDE2271           CDS       T00157                                 

Definition
(RefSeq) HAM1 protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
tde  Treponema denticola
Pathway
tde00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:tde00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TDE2271
Enzymes [BR:tde01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     TDE2271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-GeneID: 2740021
NCBI-ProteinID: NP_972871
UniProt: Q73KE7
Position
complement(2308571..2309155)
Genome map
AA seq 194 aa AA seqDB search
MKIYLASGNVNKKREVQELLPSHTIVLPKDEGIEFDPEETGSTFFENAMIKAKALYHIVK
APVLADDSGLCVDFLNGAPGIHSARYGSIEGEHVSAEAGINKVLSELKGVKDRSARFACC
MVCLLDENRFYSVQETCEGHITEAPSGSGGFGYDPIFFVEKFGKTFAELTSEQKNSISHR
GRALFSISRFIKGS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatatctggcatccggaaatgtaaacaaaaaaagggaagtgcaggagcttctt
ccgtctcatacgatcgttttgcctaaagatgagggcatagaatttgatcctgaagaaacg
ggaagtactttttttgaaaatgctatgataaaggcaaaggctctttaccatattgtaaaa
gctcctgttcttgcagatgattccggtctttgtgtcgactttttaaacggagctcccggt
attcattccgcacgatacggttctattgaaggagagcatgtttcggctgaagcaggtatt
aacaaggtcctttcagaattaaagggcgtaaaagaccgaagtgcccgttttgcttgctgc
atggtttgccttttggacgaaaaccgtttttattcggtgcaggaaacatgtgaaggtcat
ataaccgaagctccgtcaggttcgggcggtttcggctacgatcccatattctttgtagaa
aagttcggcaaaacctttgccgaacttacttctgaacaaaaaaattccatttcgcatagg
ggcagagctcttttttcaatttcaagatttataaaggggtcttaa

DBGET integrated database retrieval system