KEGG   Treponema denticola: TDE2512Help
Entry
TDE2512           CDS       T00157                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
tde  Treponema denticola
Pathway
tde00010  Glycolysis / Gluconeogenesis
tde00071  Fatty acid degradation
tde00280  Valine, leucine and isoleucine degradation
tde00310  Lysine degradation
tde00330  Arginine and proline metabolism
tde00340  Histidine metabolism
tde00380  Tryptophan metabolism
tde00561  Glycerolipid metabolism
tde00620  Pyruvate metabolism
tde00625  Chloroalkane and chloroalkene degradation
tde01100  Metabolic pathways
tde01110  Biosynthesis of secondary metabolites
tde01120  Microbial metabolism in diverse environments
tde01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDE2512
   00053 Ascorbate and aldarate metabolism
    TDE2512
   00620 Pyruvate metabolism
    TDE2512
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TDE2512
   00561 Glycerolipid metabolism
    TDE2512
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TDE2512
   00310 Lysine degradation
    TDE2512
   00330 Arginine and proline metabolism
    TDE2512
   00340 Histidine metabolism
    TDE2512
   00380 Tryptophan metabolism
    TDE2512
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TDE2512
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TDE2512
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TDE2512
Enzymes [BR:tde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     TDE2512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 2739024
NCBI-ProteinID: NP_973110
UniProt: Q73JU9
Position
2537793..2539166
Genome map
AA seq 457 aa AA seqDB search
MNQDIETIVKNCRIFFETNKTKSYEFRISQLLKLQEVLNQNKKELLNALYSDLHKTEMEG
FFSEFAIVRGELKFAIKHLKKWIKPKRVPTSIAHFKSSSKIMYEPFGTVLIMSPWNYPLN
LTLAPLVGAIAAGNCAVVKPSNYSPATSEVIKKIISENFPPEYISVITGGREENSKLLEQ
RFDYIFFTGGTTVGKLVMEAAAKYVTPVTLELGGKSPCVVEKSANLKVAARRIAFGKYLN
AGQTCVAPDYILIQDEVKEKFIEELKEALKEFFPTETYLDMHLPHIVNEKHFDRLMGLIE
GEKIITGGKGEKGRKFIEPTVLDNITFDSKIMQEEIFGPILPVISFKTIEEAIKLIKSRE
KPLASYLFTTDSNIEKKFLNEVSFGGGCINDTIVHLASDYLPFGGVGFSGIGKYHGDESF
KVFSNAKSILKKSNLIDIKLRYHPYSEKKLNIINKMM
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggatatagaaacaatcgtaaaaaattgcaggattttttttgaaacaaataaa
acaaaaagctatgagtttaggatttctcaattattaaaattacaggaagttttaaaccaa
aacaaaaaagaacttttaaatgccctttattccgacttacacaaaaccgaaatggaaggc
ttcttttcggaatttgctatcgtacgcggagaacttaaatttgcaatcaagcacttaaaa
aaatggattaaacctaaaagggttccgacctcgattgctcattttaaaagctcaagcaaa
ataatgtatgagcccttcggcaccgtgctcatcatgtcgccatggaattatcctttaaat
ttaacccttgctcccttggtaggcgccattgctgcaggaaattgtgccgttgtaaagccc
tcaaattattcgcctgcaacatcggaggttataaaaaaaataatctccgaaaactttccg
ccggaatatatatcggtaattaccggaggccgggaagaaaactcgaaacttttggagcag
cgctttgactacatcttttttacgggcggaacaactgtcggcaagctcgtaatggaagcg
gcggctaaatatgtaacccccgtaaccttggagctcggcggaaaatctccctgcgtagtt
gaaaaatctgcaaacttaaaagttgcagcccgccgaatagctttcggaaaataccttaac
gccggacaaacctgcgtagctcccgattatattttaattcaagatgaggtaaaagaaaaa
tttatcgaagaattaaaagaagctttaaaagaatttttccccacggaaacctatttggac
atgcaccttccccacatcgtaaacgaaaaacattttgaccgcctcatgggtttaattgaa
ggagaaaaaataatcacgggcggcaaaggagaaaaaggcagaaaatttattgagcccaca
gttctggataatattacctttgattccaaaataatgcaggaggaaattttcgggccaatt
cttcccgtaataagttttaagacaatagaggaagcaattaaactgattaaatcccgcgaa
aagcccctagcctcttatctttttacaaccgactcaaatatagaaaagaaattcttaaat
gaagtttctttcgggggcggctgtatcaacgatacgatagtccacttggcaagcgattac
cttcccttcggaggagtcggctttagcggcataggaaaataccacggagacgaaagcttt
aaagttttcagtaatgcaaaaagcatcctaaaaaaatcaaacctcatcgacattaaactc
cgctatcatccttattcagaaaaaaaattaaacataataaacaagatgatgtag

DBGET integrated database retrieval system