KEGG   Tenacibaculum dicentrarchi: AUW17_05595Help
Entry
AUW17_05595       CDS       T04208                                 

Definition
(GenBank) siroheme synthase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
tdi  Tenacibaculum dicentrarchi
Pathway
tdi00860  Porphyrin and chlorophyll metabolism
tdi01100  Metabolic pathways
tdi01110  Biosynthesis of secondary metabolites
tdi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tdi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AUW17_05595
Enzymes [BR:tdi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     AUW17_05595
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     AUW17_05595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M FAM180 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ALU74774
UniProt: A0A0U2RB20
Position
1266711..1267289
Genome map
AA seq 192 aa AA seqDB search
MAEQRNNLYPIFLKTNQLETLIVGGGFVALEKLSFLLKSSPNSKVLLVAPFFREETMALA
NKFSVKMITAVYHKKYLVNKNIVIATTDKVAINIQVYKDCKAQEILVNVADNPPYCDFYM
GGIVTKGNVKIAISTNGKSPTTAKRLRQFLEGVIPENIDDLVQNLNKYRKMLKGDFEQKV
RTLNLFTRSLVE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacaacgaaataatttatatccaatattcttaaaaacaaatcaactagaaacc
ttaattgttggtggtggatttgtggcgcttgaaaaattatcttttttgttaaaatcaagc
ccaaattcaaaagtgctgctagttgcgcctttttttagagaagaaacgatggctttagca
aataagttttcggttaaaatgataacagctgtgtatcataaaaaatacttggtaaataaa
aatattgtcatcgcaacgaccgataaagtggctataaatattcaagtttataaagattgt
aaagcacaagaaattttagtaaatgtggcagataatccgccgtattgtgatttctatatg
ggtggaatcgtaaccaaaggaaacgtaaaaattgcgatttctaccaacggaaaatcacct
acaactgctaaaagattacgacagtttttagagggggtaattcctgaaaatattgatgat
ttggtacaaaatttaaacaaatacagaaaaatgctgaaaggcgattttgagcaaaaagta
agaacactaaatttatttacaagaagtttagtagaataa

DBGET integrated database retrieval system