KEGG   Torulaspora delbrueckii: TDEL_0A03420Help
Entry
TDEL_0A03420      CDS       T02236                                 

Gene name
TDEL0A03420
Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00020  Citrate cycle (TCA cycle)
tdl00640  Propanoate metabolism
tdl01100  Metabolic pathways
tdl01110  Biosynthesis of secondary metabolites
tdl01130  Biosynthesis of antibiotics
tdl01200  Carbon metabolism
Module
tdl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tdl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TDEL_0A03420 (TDEL0A03420)
   00640 Propanoate metabolism
    TDEL_0A03420 (TDEL0A03420)
Enzymes [BR:tdl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     TDEL_0A03420 (TDEL0A03420)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TDEL_0A03420 (TDEL0A03420)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 DUF4817
Motif
Other DBs
NCBI-GeneID: 11502658
NCBI-ProteinID: XP_003678885
UniProt: G8ZM30
Position
1:611671..612657
Genome map
AA seq 328 aa AA seqDB search
MLRSTVTKNPAFRRLFSRESTPNDKTIRNLLLPKDTKVIIQGFTGKQATFHAKISQEYGT
NIVGGTNPKKAGQTHLGQPVFATVKDAMKEVGATATGIFVPPPIAAAAIKEAIEAEIPLA
VCITEGIPQHDMLYVAEMLKSQDKTRLVGPNCPGIINPGTRVRIGIQPPKIFKPGNIGIV
SKSGTLTYEAVQQTTLAGLGQTMVIGMGGDAFPGTDFIDALKLFMEDPATEGIIMLGEIG
GQAEIEAAQFLKEYNFSRANPLPVASFIAGKVAGQMKGVRMGHSGAIVEGSGTDAESKKK
ALNEAGVTVVESPGHLGKALLDGFARLK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgctaagatcaacagtcaccaagaatcctgcgtttcgccgtctattttctcgcgagagt
actcccaatgacaagactattaggaacttactcttgcccaaggataccaaggtgattatt
caagggtttactgggaaacaggctactttccacgccaaaatttctcaggagtatggtact
aacattgtaggtggtactaaccctaaaaaggctggtcagactcatttgggtcaaccagtt
tttgccactgtgaaagatgccatgaaagaggttggtgctactgctaccggtatatttgtt
ccaccaccgattgctgctgcagctatcaaagaggcaattgaagctgagatcccactagca
gtttgtatcactgagggtatcccacaacatgatatgctttacgttgcagagatgctgaaa
tctcaggataagaccagattggttggtccaaactgtcccggtattattaaccccggaacc
agggtaaggattggtatccaaccaccaaagatctttaagccaggtaatattggtatcgtg
tcaaagtctggtactttgacatacgaagctgtgcaacaaactactttggccgggttggga
caaaccatggtcatcggtatgggaggtgacgcattcccgggtaccgatttcatcgatgca
ttgaagttgttcatggaagacccagccactgaaggtatcattatgttgggtgaaattggt
ggtcaagctgagatcgaagccgctcagttcctaaaagaatataacttctcaagagcaaac
ccactgcctgttgcctccttcattgctggtaaagtcgcaggtcaaatgaagggtgtcaga
atgggtcattccggtgctatcgttgaaggttctggtaccgacgccgaatcaaagaagaag
gctttgaatgaagcaggtgttaccgtcgtcgaatctcctggtcatttgggtaaggccctt
ttggatggatttgccaggttgaagtag

DBGET integrated database retrieval system