KEGG   Torulaspora delbrueckii: TDEL_0A04370Help
Entry
TDEL_0A04370      CDS       T02236                                 

Gene name
TDEL0A04370
Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00230  Purine metabolism
tdl01100  Metabolic pathways
Module
tdl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TDEL_0A04370 (TDEL0A04370)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TDEL_0A04370 (TDEL0A04370)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_22 MMR_HSR1 AAA_18 RNA_helicase AAA_30 AAA_28 AAA RsgA_GTPase AAA_24 ABC_tran AAA_29 NACHT AAA_14 T2SSE AAA_5 NTPase_1 DUF2075 MobB Cytidylate_kin ATPase_2 TsaE Pox_A32 AAA_17 Rad17 cobW AAA_25
Motif
Other DBs
NCBI-GeneID: 11503010
NCBI-ProteinID: XP_003678980
UniProt: G8ZMC5
Position
1:complement(773339..773902)
Genome map
AA seq 187 aa AA seqDB search
MPRPIVLSGPSGTGKSTLLKKLFAEFPNKFGFSVSSTTRSPRAGEVDGKDYNFVPVEEFK
RMISADEFVEWAQFSGNYYGTTVASVKKVADSGRTCILDIDMQGVKSVKYKTDLDARFLF
VAPPSVADLEKRLRGRGTETEESIAKRLAAAKAEIEYAETGAHDQILVNDDLQRAYNELK
EFIAQEE
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtcctatcgttttgtctggccccagtgggactggtaagtccactttgctcaag
aaattgttcgccgagtttcccaacaagtttggtttcagcgtttcttcaaccactcgttct
ccaagagctggtgaggttgatggtaaggactacaactttgttccagtcgaggagttcaaa
aggatgatttctgcagacgagtttgtcgaatgggctcaattttcaggcaattattatggg
accacagttgcttctgtcaagaaagtcgccgactctggtagaacttgtatcttggacatc
gatatgcaaggtgttaagtctgtcaagtacaagaccgacctagacgcaagatttctgttt
gtagctccaccttcagtggcagatttggagaaaagacttagaggtagaggtactgagacc
gaagaatccattgccaagagacttgcagcagccaaggctgaaatcgagtacgcagaaaca
ggcgcccacgaccaaatattggtcaatgacgacctccagagagcctacaacgagctcaag
gagttcattgcccaggaagagtga

DBGET integrated database retrieval system