KEGG   Torulaspora delbrueckii: TDEL_0A05460Help
Entry
TDEL_0A05460      CDS       T02236                                 

Gene name
TDEL0A05460
Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00220  Arginine biosynthesis
tdl00330  Arginine and proline metabolism
tdl01100  Metabolic pathways
tdl01110  Biosynthesis of secondary metabolites
tdl01130  Biosynthesis of antibiotics
tdl01230  Biosynthesis of amino acids
Module
tdl_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    TDEL_0A05460 (TDEL0A05460)
   00330 Arginine and proline metabolism
    TDEL_0A05460 (TDEL0A05460)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TDEL_0A05460 (TDEL0A05460)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase DUF3129
Motif
Other DBs
NCBI-GeneID: 11502999
NCBI-ProteinID: XP_003679089
UniProt: G8ZMN4
Position
1:complement(957597..958571)
Genome map
AA seq 324 aa AA seqDB search
MDAEQAPTYNYFKNKELALVLAPFAGGQGHVGVENGPKYMLQHGLESQLQELGWKTTIER
PLDNESIVKKMLQDTSKDAYGHIKRPNLVGEATELIYKTVKKSLQEGKFPLTLGGDHSIA
IGTVSGVLDKFPDAGLLWIDAHADINTLESTESGNLHGCPVSFLMGLDKDNECPEALKWV
PGNLRPEKIAYIGLRDIDAGEKKILRELGIKAFSMYHVDRYGINNVIEMALKAINPDGKG
PVMCSYDVDAVDPLFVPATGTPVRGGLTLREALFLSERLAETGDLVALDVVECNPALATH
DLHIVDTISAGCAIARCALGETLI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgaacaagccccaacatacaattacttcaaaaacaaagaattagcattggtg
cttgcaccttttgctggtggccagggccatgtcggtgttgaaaatggaccaaaatatatg
ttacaacatggtttggaatctcaactgcaagagctcggttggaaaactactattgaacgt
ccacttgacaacgaatccatcgtgaaaaaaatgctccaggatacttccaaggatgcatat
ggtcatattaaacgtcctaacctggttggagaagccactgaacttatttacaagacagtg
aagaaaagtctacaagagggaaagttcccattgacacttggaggagatcactctatcgcc
attggtacagtttcgggagtattggacaaatttccagacgctggactgctttggatcgat
gcacacgcagatattaacacattagagtctacagaatcaggaaaccttcacggttgccct
gtatcattcctaatgggtcttgacaaggacaatgaatgccctgaagcactcaaatgggtt
ccaggtaacttaagaccggaaaagattgcatatattggactcagagatatcgatgcgggt
gaaaagaagatcctacgtgaactcggcattaaagctttctccatgtaccacgttgaccgt
tacggaatcaataacgttattgaaatggctttgaaagctattaaccctgatggtaaggga
ccagtaatgtgctcttacgatgtcgacgcagtcgacccactgttcgttccagctaccggg
accccagtaagaggaggactaactctaagagaagcattgtttctgtccgagagactagca
gaaacaggagacctggtagcactcgacgtagtcgagtgcaatcctgccttggcaactcat
gatctacatattgttgatacaatctcagccggctgtgccatcgccagatgtgcgctgggt
gaaacactaatctaa

DBGET integrated database retrieval system