KEGG   Torulaspora delbrueckii: TDEL_0A07260Help
Entry
TDEL_0A07260      CDS       T02236                                 

Gene name
TDEL0A07260
Definition
(RefSeq) hypothetical protein
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00061  Fatty acid biosynthesis
tdl00620  Pyruvate metabolism
tdl00640  Propanoate metabolism
tdl01100  Metabolic pathways
tdl01110  Biosynthesis of secondary metabolites
tdl01130  Biosynthesis of antibiotics
tdl01212  Fatty acid metabolism
Module
tdl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TDEL_0A07260 (TDEL0A07260)
   00640 Propanoate metabolism
    TDEL_0A07260 (TDEL0A07260)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    TDEL_0A07260 (TDEL0A07260)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    TDEL_0A07260 (TDEL0A07260)
Enzymes [BR:tdl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     TDEL_0A07260 (TDEL0A07260)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     TDEL_0A07260 (TDEL0A07260)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     TDEL_0A07260 (TDEL0A07260)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter ATP-grasp_3 Dala_Dala_lig_C RnfC_N
Motif
Other DBs
NCBI-GeneID: 11502685
NCBI-ProteinID: XP_003679269
UniProt: G8ZN64
Position
1:complement(1267754..1274434)
Genome map
AA seq 2226 aa AA seqDB search
MSEENLFEVSGSEMTDYSQKHAKLAPHFLGYRNVNSTEDSPLKNFVKSHGGHTIISKVLI
ANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPEDLEANAEYIRMADQYVEVPGGTN
NNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPESLARSKRKVIFIGPPGSAMRSLG
DKISSTIVAQHAKVPCIPWSGTGVDQVFVDEETNLVSVQDDVYQKGCCSSPEDGLAKAKE
IGFPIMIKASEGGGGKGIRKVEREEDFISLYHQAANEIPGSPIFIMKLAGKARHLEVQLL
ADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFSEMERAAVRLGKLVGYVSAGTV
EYLYSHDDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPMHRIKDIRLLYGL
NPHTATPIDFEFKSEESLKVQRKPIPKGHCTACRITSEDPNEGFKPSGGSLHDLNFRSSS
NVWGYFSVGNNGGIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLI
KLLETEDFEENTITTGWLDDLISQKMTAEKPDPTLAVICGAATKAFIASEAARQEYINSL
KRGQVPAKTLLQTMFPVEFIHDSKRYKFTVAKSADDRYTLFINGSKCEVRARKLSDGGLL
IAVGGNSHTIYWKEEVAATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFIVENGDHVVA
GQPYAEVEVMKMQMPLIAQESGVVQLLKQPGSTIAAGDIIAILSLDDPSKVKHALPFEGM
LPDLGAPSIEGTKPAYKFKSLVTTLENILNGYDNQVIMNASLQQLIEVLRDPKLPYSEWK
MQISALHSRLPAQLDEQLEQLVDRSAKRSAIFPARQLSKLMEGALKQKDAGLLSTVMEPL
LDITSRYANGLAAHEHSVFVKFLEEYYNVEKLFNGPNVREENVILKLRDENIDNLEKVVL
IVLSHSKVSAKNNLILAILKHYQPLCKISSDVAATISVPLQHIVELQSKATAKVALQARE
ILIQGALPSVKERTEQIEHILKSSVVQASYGATKPKRTEPNMEVLKDLIDSNYVVFDVLT
QFLSYSDPAVAAAAAEVYVRRAYRAYTIGDVQVHTNTSNPICEWKFQLPSAAFTAIPQMK
SKLGMNRAMSVSDLTYTADSQSSPSRTGILVSAEHLDDVDDVLSQSLEIIPRASSSASGP
APDRSGSTQSLSNVANIYVNSTDGFESEESVLKRLTEILETSKQELISSAIRRITFMFGY
SDGSYPKYYTFKGPAYDEDQTIRHIEPALAFQLELGRMSNFNIKSIFTENRNIHVYEAVG
KTSPLDKRFFTRGIIRTGRIRDDISIQEYLTSEANRLMSDILDNLEIIDTSNSDLNHIFI
NFSAVFDVSPEDVEAAFGGFLQRFGKRLLRLRIASAEIRIIIKDPKTETPVPLRALINNV
SGYVVKTELYTEVKNAKGDWVFKSLGKPGSMHLRPIATPYPVKEWLQPKRYKAHLMGTTY
VYDFPELFHQAAISQWEKYSSEAKISDDFFIANELIEDENGELTEVDREPGANAIGMVAF
KITVKTPEYPRGRQFVVVANDITFKIGSFGPQEDEFFNKVTEYARKRGIPRIYLSANSGA
RIGIAEELVPLFQVAWKDPSDSTKGFDYLYLNSENLEELKKYGKEQSVVTERIVEGGEER
HVIKAVIGADDGLGVECLKGSGLIAGATSKAYHDIFTVTLVTCRSVGIGAYLVRLGQRAI
QIEGQPIILTGAPAINKVLGREVYSSNLQLGGTQIMYNNGVSHLTAADDLAAVERIMEWL
SYVPAKRNMPVPILETEDKWDREIDFVPHKDEPYDVRWMIAGRDSEEGFESGLFDKGSFF
ETLSGWAKGVVVGRARLGGIPLGIIAVETKMVENLIPADPANPDSTESLVQEAGQVWYPN
SAFKTAQAINDFNYGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVDYKQPIMI
YIPPTGELRGGSWVVVDPAINPEQMEMYADVESRAGVLEPAGMVGVKYRREKLLGTMARL
DPTYKQLKQKLADSSLSSEEHQEISKKLAAREQLLSPIYSQISVQFADLHDRSTRMLAKG
VIRRELHWREARRFFFWRLRRRLNEEYLIKRLDAELPLASRLEKIARLRSWYPASVDHEN
DRQVATWIEENYQLLDEHLKSLKLESFAQGLAKSLRSDHDNVINGLSEVLKMLSTEDKEK
ISKSLK
NT seq 6681 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaaaacctttttgaagtgtctggtagtgaaatgacagactattctcagaaa
cacgccaagctggcgccgcattttctagggtaccgtaatgtaaattctaccgaggattca
cctttaaagaattttgtcaaatcccatggtggtcatactatcatatcgaaagtgctgatt
gccaataacggtatagccgcagtcaaagagattcgttccgtaaggaaatgggcctatgag
acttttggcaatgaaagagctgttcaattcgttgcaatggctacaccagaagatttggaa
gctaacgctgaatatataaggatggccgatcagtacgtcgaagtaccaggtggtacaaac
aacaacaactacgcaaacgtcgatctgatcgtcgatatcgctgagagagctgatgtcgat
gccgtctgggcaggttggggtcacgcatcggaaaatcctctactaccggaaagtttggct
agatccaagaggaaagttatctttatcggtccaccaggttctgccatgagatctttgggt
gacaagatttcatccactatcgtcgcccaacacgctaaagtaccatgtatcccatggtca
ggtactggtgtcgatcaagtttttgtcgatgaagaaaccaatttagtctctgtgcaagat
gatgtttatcaaaagggttgttgctcctctccagaagatggtttagcaaaagccaaggaa
attggtttcccaattatgatcaaagcctctgaaggtggtggtggtaaaggtatcagaaaa
gttgaacgtgaagaggactttatctccttgtaccaccaagcagcaaacgaaattccaggt
tctccaatctttattatgaagttggccggtaaggcacgtcatttggaagttcaattattg
gctgatcaatatggtaccaacatttctttgtttggtcgtgattgttccgtgcaaagacgt
caccaaaaaatcattgaagaagctcctgttaccatcgctaaaccggacactttctcggag
atggaaagagccgctgtcagattgggtaaattggtcggctacgtctctgctggtactgtc
gagtacctgtattctcatgatgatgataaattttatttcttggagttgaacccaagattg
caagtcgagcatccaaccactgaaatggtttctggtgttaacttgcctgcagctcaatta
caaattgctatgggtatcccaatgcatagaattaaagatattagactgctatacggtttg
aacccacataccgctactccaatcgattttgagttcaaatcagaagaatctttgaaggtt
caaagaaagccaattccaaagggtcactgtacggcttgtcgtatcacttctgaagatcca
aacgaaggtttcaagccatctggtggttccttgcacgatttgaacttccgttcatcttca
aatgtttggggttatttctcggttggtaataatggtggaatccactctttctcagactcc
caattcggtcatatcttcgcttttggtgaaaataggcaagcgtctagaaagcacatggtt
gttgctctgaaagaattatccattagaggtgatttcaggactactgtcgaatatttaatt
aagcttctagagaccgaagattttgaagagaataccatcaccaccggttggttagatgat
ttgatctctcaaaagatgaccgctgagaagccagatccaactttggctgttatttgtggt
gccgctactaaggcctttatcgcttctgaagctgctcgtcaagagtacattaactctctg
aagagaggtcaagttccagcaaagaccttactacaaaccatgttcccagttgaatttatc
cacgatagcaagagatacaagtttactgtggccaagtctgctgatgatcgttacactctg
ttcatcaatggttcgaaatgtgaagtacgtgctcgtaaactttctgatggtggtcttttg
atcgctgttggtggtaactctcacactatctactggaaggaggaagttgctgccactagg
ctgtctgtcgactccatgactactttgttggaagtcgagaacgatccaacccagctacgt
actccatccccaggtaaactggtcaagttcatcgtcgagaatggtgatcatgtcgtcgct
ggtcaaccttacgctgaagttgaagtcatgaagatgcaaatgcctttgattgcacaggaa
agtggtgttgttcaactcctaaagcaacctggttctactattgccgctggtgatataatc
gccatcttgagtttggacgatccatccaaggtgaagcacgctctacctttcgaaggaatg
cttccagacttaggtgctccaagcattgaaggtactaagccagcttacaagttcaagtca
ttggtcactactttggaaaacatcttgaatggttacgataaccaagttatcatgaatgca
tctctacaacaattgattgaagttttgagagatccaaaactaccatactctgaatggaaa
atgcaaatttctgctctacattctagattgccagcccaacttgatgagcaactagagcaa
ttggtcgacagatcggccaaacgttcggctattttcccagcaagacagttatctaaactt
atggaaggtgctttgaagcaaaaagatgctggtttgctgagtactgttatggaaccactt
ttggacattaccagccgttacgctaacggtctggctgctcatgagcactctgtctttgtc
aaattcctagaagagtactacaatgttgagaaattgttcaacggtccaaatgttcgtgaa
gagaatgtgatcttaaagcttcgtgatgaaaacatagacaacttagaaaaggtggtcctg
attgttctttctcactctaaagtctctgcaaagaacaatttgattttggcaattctaaag
cactaccaacctttgtgtaaaatctcttctgatgttgctgctactatctctgttccattg
caacacattgtcgaattgcaatccaaggctaccgccaaggttgctttgcaagcaagagag
atcttgattcaaggtgctttgccatccgtcaaggaaagaaccgagcagatcgaacacatt
ctgaaatcttcagtggttcaagcttcttacggtgccacaaagccaaagcgtactgagcca
aacatggaagttctaaaggatttgatcgattctaactacgttgtgttcgatgtcttgacc
caattcttgagctattctgatcctgctgtcgctgccgctgccgctgaagtctatgtccgt
agagcttacagagcgtacaccatcggtgacgttcaagttcataccaacactagtaacccc
atctgtgagtggaaattccaattaccatcagctgctttcaccgcaatccctcaaatgaaa
tctaagcttggtatgaacagagctatgtccgtatctgatttgacttacacagctgatagc
caaagctctccttcaagaactggtatcttggtttccgctgagcatctggatgatgttgac
gatgtcttgtctcaaagtctagaaatcatcccaagagcttcttcttctgccagtggtcca
gctccagacagatctggtagtacccaatctttgagtaacgttgccaacatctacgtcaac
tctaccgacggtttcgaatcggaagaaagtgtgttgaagagattgactgaaatcttagaa
actagcaaacaggagttgatctcttctgctatccgtcgtatcacctttatgttcggttac
agtgatggttcttatccaaagtactacactttcaagggcccagcttacgacgaagatcaa
actattcgtcacatcgaacccgcgctggctttccaactagaattaggaagaatgtcaaac
ttcaacattaagtcgatcttcactgaaaacagaaacatccatgtctacgaggctgttggt
aagacttctccacttgataagagatttttcaccagaggtatcatcagaactggccgtatc
cgcgatgatatttccattcaagaatacttgacttcggaagccaacagattgatgagtgac
attttggacaacttggaaatcatcgatacttctaactctgacttgaatcatatcttcatc
aacttctctgcagtctttgatgtctctccagaagatgttgaggctgccttcggtggtttc
ttacagagattcggtaagagattactaagactgagaattgcttctgctgaaatccgtatc
ataatcaaggacccaaaaactgaaactcctgttcctttgcgtgccttgattaataacgtc
tctggttacgttgtcaagactgagctatacactgaagtcaagaacgctaagggtgactgg
gtattcaagtccctcggtaagccaggttccatgcatctaagaccaattgcaactccatac
ccagtcaaagaatggttgcaaccaaagcgttacaaggcccacttgatgggaactacttac
gtttacgatttcccagaactattccaccaggcggctatttctcaatgggagaaatactct
tctgaggccaaaatttccgatgacttcttcattgcaaacgaactgatcgaagatgaaaat
ggtgaattgaccgaagttgaccgtgaacctggtgccaatgccatcggtatggttgccttc
aagatcactgtgaagactccagaatatcctcgtggccgtcaatttgttgttgtcgcaaac
gatatcactttcaagattggttctttcggtcctcaagaagatgagttcttcaacaaggtt
accgagtacgcaagaaagcgcggtatcccaagaatctacctatcagccaactctggtgct
agaatcggtatcgctgaagaattggtcccattattccaagttgcttggaaagatccatct
gactcaacgaagggttttgactacttgtatttgaactccgagaatttggaagagttgaag
aaatacggtaaggaacaatctgttgttactgaacgtattgttgaaggcggtgaagagaga
cacgtcatcaaagcagtcatcggtgctgatgatggtttaggtgttgagtgtttgaagggt
tctggtttgattgctggtgccacttccaaagcttaccacgacattttcactgtgactttg
gtcacctgtagatctgtcggtattggtgcctacttggttaggttgggtcaaagagccatc
caaattgaaggtcaaccaatcatcttgaccggtgctcccgctatcaacaaggttttgggt
agagaggtttactcctccaacttgcaacttggtggtactcagatcatgtacaacaatggt
gtctctcatttgaccgcagcagatgatttggcagccgttgagagaattatggaatggtta
tcttatgttccagctaaacgtaacatgccagtgccaatcttggagaccgaagacaaatgg
gacagagaaatcgattttgttccacataaggatgaaccttatgatgtcagatggatgatc
gctggtcgcgattctgaagaaggcttcgagtctggtttgttcgataagggttctttcttc
gaaactttgtctggatgggcaaagggtgttgtcgtcggtagagctcgtttgggtggtatt
ccattaggtattatcgctgttgaaaccaagatggttgagaacttgattcctgctgatcca
gccaacccagattctactgaatcattggtccaagaagctggtcaagtttggtatccaaac
tctgctttcaagaccgctcaagctatcaatgacttcaactatggtgagcaattaccattg
atgatacttgccaactggagaggtttctctggtggtcaacgtgatatgtacaatgaagtt
ttgaagtacggttccttcattgttgacgccttggttgactataagcaacctatcatgatt
tacattccgccaactggtgaattgagaggtggttcctgggtcgttgttgatccagccatc
aaccctgaacagatggaaatgtacgctgacgttgaatctagagctggtgtcttggaacct
gccggtatggttggtgtcaagtaccgtagagagaaactactaggcactatggccagattg
gatccaacttacaagcaattgaagcaaaaacttgctgattcttccttatccagcgaagaa
catcaagaaatttccaagaaattggctgctcgtgagcaattgctatctccaatctatagt
caaatcagtgtccaatttgccgacttgcatgacagatccactcgtatgttggccaagggt
gtaatcagaagagaattgcactggagagaagctcgtcgcttcttcttctggagattgaga
cgtagattgaacgaagagtacttgatcaagagacttgacgcagaactgccattagcatcc
agactagagaagattgctagactacggtcatggtacccagcatctgttgatcacgaaaat
gaccgacaagttgccacctggattgaggaaaactaccagttactagatgaacacttgaaa
tctttgaaattggaatcattcgctcaagggttggctaagtcactaagaagtgaccacgac
aacgttatcaatggcctatctgaggtcttgaagatgttgtccactgaggacaaggagaag
atctccaagagtctgaaataa

DBGET integrated database retrieval system