KEGG   Torulaspora delbrueckii: TDEL_0D03050Help
Entry
TDEL_0D03050      CDS       T02236                                 

Gene name
TDEL0D03050
Definition
(RefSeq) hypothetical protein
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00760  Nicotinate and nicotinamide metabolism
tdl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TDEL_0D03050 (TDEL0D03050)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     TDEL_0D03050 (TDEL0D03050)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     TDEL_0D03050 (TDEL0D03050)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 11502324
NCBI-ProteinID: XP_003681100
UniProt: G8ZTE5
Position
4:complement(572635..573939)
Genome map
AA seq 434 aa AA seqDB search
MDPTRAPDFKPASADEEPQPPPDPTSTIPKSKPIVPYVLADYNSSIDAPFNLVSLKKNLA
YQRKTRRVLVVRFVILKDPNVAFTVSNNHRRSNHIPWSQSDFQPLSENMSNTEDDDEDGD
EDKAYFDEVDRNLDLGSKSTFDDIDEQMGGISIGVRKNQIADLEEVPHGIVRQARNIENY
EFPTHRLAKRLQDHNKLPLVIVACGSFSPITYLHLRMFEMALDAICEQTRFEVIGGYYSP
VSDTYQKRGLAASHHRVRMCELACERTSSWLMVDAWESLQPTYTRTAKVLDHFNHEINVK
RGGVRNVTGDKMGVKIMLLAGGDLIESMGEPNVWADADLHHILGNYGCLILERTGSDVRS
FLLSHDIMYEHRRNVLVIKQLIYNDISSTKVRLFIRRNMSVQYLLPNSVIRYIQEHGLYV
NQTEPVKQVMGTKD
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaccctactagagcccctgatttcaaaccagcttctgcagatgaagaaccacaacct
ccaccagatccaacttctacgatcccaaaatctaaaccaattgttccatatgtcttggca
gattataattcatccatagatgctccttttaatctggtaagtttaaaaaaaaatctggcc
tatcaaaggaaaacgagaagggttctcgtcgtaaggttcgtcattttaaaagatccaaat
gttgcatttaccgtaagtaacaatcatcgtcgttcaaatcatattccttggagtcaatcc
gatttccaacctttgtctgaaaatatgtccaatacagaagatgatgacgaggatggagat
gaagataaagcttatttcgatgaggtcgatcgtaatttggatctaggctcaaaatccact
ttcgatgatattgatgaacagatgggtggaatcagtataggggtacgaaaaaatcagatc
gctgatcttgaagaagtgcctcatggaatcgttcgtcaggcgagaaatattgaaaactat
gaattcccaacgcacagattggccaagaggttacaggatcacaacaaattgcctttggtc
attgtggcgtgtggttctttctctccgatcacttatttgcatttacgaatgtttgaaatg
gctttggatgctatctgcgaacagacccgcttcgaagtcatcggtggctattactcacct
gtgagtgatacttaccagaagagagggctggcggcttctcaccatagagtgcgtatgtgt
gaactggcatgtgaaagaacttcttcctggctgatggtcgatgcgtgggaatctttgcag
cctacttacacgaggaccgctaaagtcttggaccattttaatcacgagattaacgtcaag
agaggtggtgtgcgtaatgttactggtgataagatgggtgtcaagatcatgttactcgca
gggggcgatttgatagaatccatgggagaaccaaatgtctgggcagatgcagacctgcat
catattctcggtaattatggctgtttaatcctcgagagaacaggttcagatgtcagatct
ttcttattgtcgcacgatatcatgtatgaacacaggagaaacgtgttggtaatcaaacaa
ctgatctataatgacatttcctctacaaaggttcgtttgttcatcagacgtaatatgtcg
gttcaatacttgctgcctaattccgtcatcagatacattcaggaacatgggctgtatgtc
aatcaaacagagcctgtcaagcaagtcatgggtaccaaagattga

DBGET integrated database retrieval system