KEGG   Torulaspora delbrueckii: TDEL_0D03380Help
Entry
TDEL_0D03380      CDS       T02236                                 

Gene name
TDEL0D03380
Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00010  Glycolysis / Gluconeogenesis
tdl00051  Fructose and mannose metabolism
tdl00562  Inositol phosphate metabolism
tdl01100  Metabolic pathways
tdl01110  Biosynthesis of secondary metabolites
tdl01130  Biosynthesis of antibiotics
tdl01200  Carbon metabolism
tdl01230  Biosynthesis of amino acids
Module
tdl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tdl_M00002  Glycolysis, core module involving three-carbon compounds
tdl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDEL_0D03380 (TDEL0D03380)
   00051 Fructose and mannose metabolism
    TDEL_0D03380 (TDEL0D03380)
   00562 Inositol phosphate metabolism
    TDEL_0D03380 (TDEL0D03380)
Enzymes [BR:tdl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TDEL_0D03380 (TDEL0D03380)
Exosome [BR:tdl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TDEL_0D03380 (TDEL0D03380)
  Exosomal proteins of bladder cancer cells
   TDEL_0D03380 (TDEL0D03380)
  Exosomal proteins of melanoma cells
   TDEL_0D03380 (TDEL0D03380)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 11502356
NCBI-ProteinID: XP_003681133
UniProt: G8ZTH8
Position
4:complement(630256..631002)
Genome map
AA seq 248 aa AA seqDB search
MARTFFVGGNFKLNGSKKSIKEIVERLNQASLSENVEVVLCPPAPYLEYTASLVQKKQIT
VGAQNTWTKASGAFTGENSVDQVLDVGAKWVILGHSERRTIFHEDDKLIAEKTKFALDQG
AGVIFCIGETLEEKKAGVTLDVCERQLNAAIAEVKDWTNVVVAYEPVWAIGTGLAATAED
AQDIHASLRKLLAAKLGDKVAQQTRILYGGSANGSNVASFKDKADVDGFLVGGASLKPEF
VDIVNSRK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctagaacttttttcgtcggtggtaacttcaaattgaacggttccaagaaatctatc
aaggaaatcgttgaaagattgaaccaagcttctctatcagagaacgttgaagttgttcta
tgtccacctgctccatacttggaatacaccgcttctttggtccaaaagaagcaaattacc
gtcggtgctcaaaacacctggaccaaggcttctggtgctttcactggtgaaaactctgtt
gaccaagtcctagacgttggtgctaagtgggtcatcctaggtcactccgagagaagaact
atcttccacgaggatgacaagttgatcgctgaaaagaccaagttcgctttggaccaaggt
gctggtgtcatcttctgtatcggtgagactttggaagaaaagaaggctggtgttactcta
gatgtctgtgaaagacaattgaacgctgccattgccgaagtcaaggactggactaacgtt
gttgttgcttacgaaccagtctgggctattggtaccggtttggccgctactgctgaagat
gctcaagacatccacgcttctctaagaaagctattggctgctaagttgggtgacaaggtc
gctcaacagaccagaatcctatacggtggttccgctaacggttccaacgtggcctctttc
aaggacaaggccgatgtcgatggtttcttggtcggtggtgcttctttgaagccagaattc
gttgacattgtcaactccagaaaataa

DBGET integrated database retrieval system