KEGG   Torulaspora delbrueckii: TDEL_0D05430
Entry
TDEL_0D05430      CDS       T02236                                 

Gene name
TDEL0D05430
Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00100  Steroid biosynthesis
tdl01100  Metabolic pathways
tdl01110  Biosynthesis of secondary metabolites
Module
tdl_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    TDEL_0D05430 (TDEL0D05430)
Enzymes [BR:tdl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     TDEL_0D05430 (TDEL0D05430)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 11503494
NCBI-ProteinID: XP_003681338
UniProt: G8ZU33
Position
4:982805..984118
AA seq 437 aa
MASKLNPKTKNIEFGGAPGALAISVGLPILTIVLNQMVRPDYFIKGWFSNFEFAQLWNGI
KSSRYYFTRYDLWTYYTAWHLGLAALATILPGKKMNGVELRDGTSLPYKINGIAMSAALF
LILAVRWQLTQGQLPELQFLYDNHVDLCIVTILYAFLLSVYVYVTSFFPLLGKNGHNTKE
RILALGGNTGNPIYDWFIGRELNPRLGPLDIKLFCELRPGMLLWLLINLSCLHHQYLKTG
ELNNALLVVNLLQGFYIFDGILNEEGCLTMMDITTDGFGYMLAFGDLSLVPFTYSLQARY
LSVSPITLTNYQLATIFGFMVTGFYIFHKSNMQKSLFRQGKLPHLNSIATKRGTKLLCDG
WWAKSQHINYFGDWLISLSWCLTTWFQTPLTYYYSLYFATLLLHRQSRDEHKCREKYQES
WEEYERNVPYKIVPYIY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcgtccaaattaaaccctaaaactaagaatatagaatttggcggagcacccggtgcg
ctggctatctctgttggtttgcccatattgactattgttcttaaccaaatggttaggccc
gattacttcatcaagggctggttttctaattttgaatttgctcaactttggaatggcatc
aaatcctctagatattatttcaccaggtacgatttgtggacatattataccgcatggcac
ttgggtctagccgctttggctaccatcttaccaggaaagaaaatgaacggtgtagagctt
agagatggaaccagtttgccctataagattaatggaattgccatgtcagccgcgcttttc
ttgatccttgccgttagatggcaattgactcaaggtcagctacctgagttgcaattcttg
tacgacaaccatgttgacttgtgcatcgtcaccatcctatatgctttcctactctcagtc
tacgtttacgttaccagtttcttcccattattgggtaaaaatggacataataccaaggaa
aggatccttgcgctgggcgggaacactggcaacccaatttacgactggtttatcggcaga
gaattaaaccccagactaggtcccttagatatcaagctattttgcgaattgaggcctggt
atgttgttgtggttattgatcaatttatcctgtctgcatcatcaatatttgaagactggt
gaattgaacaacgctttgctcgttgtgaaccttttgcaaggattctatattttcgacggt
atcttaaacgaagaaggatgtttaacaatgatggacatcactacggatggtttcggctat
atgcttgcctttggtgatctatctctagtcccattcacttactccttacaagcgcgctac
ttgagtgtatctccaattactttaaccaactaccagttggcaacaatctttgggttcatg
gtcacaggtttctacatcttccacaagtccaacatgcaaaaatcgctgttcagacaaggc
aagctacctcatctaaacagtatcgccactaagcggggtactaaactactgtgtgatggc
tggtgggccaaatctcaacatatcaactatttcggcgattggttgatctcgctaagttgg
tgcctaaccacctggttccaaactcctttgacgtattactactcgttatatttcgccaca
ttgctactacaccgccaatcgagagacgaacacaagtgccgtgaaaagtaccaagaaagt
tgggaagagtacgagagaaatgtgccttacaagattgttccctacatatactaa

DBGET integrated database retrieval system