KEGG   Torulaspora delbrueckii: TDEL_0F00710Help
Entry
TDEL_0F00710      CDS       T02236                                 

Gene name
TDEL0F00710
Definition
(RefSeq) hypothetical protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00564  Glycerophospholipid metabolism
tdl01100  Metabolic pathways
tdl01110  Biosynthesis of secondary metabolites
Module
tdl_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TDEL_0F00710 (TDEL0F00710)
Enzymes [BR:tdl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     TDEL_0F00710 (TDEL0F00710)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase NADH_oxidored
Motif
Other DBs
NCBI-GeneID: 11501184
NCBI-ProteinID: XP_003682093
UniProt: G8ZW88
Position
6:complement(125712..127187)
Genome map
AA seq 491 aa AA seqDB search
MIPVGKALNRGRSIITMPVGRLATKMQFRNRTAVLWSRSFATGGVVSQKHKAGEIVKRGK
EAKLLSQKSVIKWVVLTGVTIALGTVILNSQTRDEDEAEDEETKGRKRLPRIRIFDNDWL
FFCYSTLPLNALSRLWGQVNSLNLPVWLRPWGFKCYSYLFGVNLDEMVDQDLKNYANLSE
FFYREIRPNCRPIDTRENVVVCPSDGKILKIGIIDSESGEIEQVKGLTYSIKDFLGTHSH
PTMSKSESSLDLNSDEEKHKEFARQIDFRLSDQSGHESEHYLNVKEEGDKVIEEAKPSIS
KSMKLLNELSLMPGSYHMPYNEPNDTQLYFAVVYLAPGDYHHYHSPVNWVCKLRRHFPGD
LFSVAPYFQRNFPNLFVLNERVALLGHWKHGFFSMTAVGATNVGSIKLSFDKELVTNVRR
KKHNEPHSCYEATYQNASKILGGMPLIKGEEMGGFMLGSTVVLCFEAPRGFQFDVKVGDK
VKLGQALGAVE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgataccggttgggaaggctctaaaccgtgggagaagtatcattacgatgcctgtagga
cgtttggcaactaagatgcagttccgtaaccggactgctgttttatggagtagaagtttt
gccacgggaggagtggtgtcgcagaaacataaagctggagaaattgtcaaacgtggtaag
gaggctaaacttttatcccaaaaatccgttatcaagtgggttgtattgacaggtgtgact
atagcattaggaactgtcattctcaattctcagactagggatgaagatgaagccgaagat
gaagagacaaaaggtcgcaagaggttgccaagaattaggatctttgataatgattggctc
ttcttttgctactctacgttacctttgaatgctttgtctcgcctttggggccaagttaat
tctcttaatttaccggtatggctcagaccttggggatttaagtgttattcgtacttgttc
ggtgttaatttagatgaaatggtagaccaagatctgaaaaactacgcaaatctatctgaa
tttttttatcgagagataagacctaactgcagacccattgacactcgtgaaaatgtggtg
gtttgccccagtgatggtaagatcttgaaaattggtattatagattctgaaagtggtgag
attgaacaagtcaaagggttaacctattctatcaaggatttcttaggtacacattctcac
ccgacaatgtccaaaagtgagtcaagtctagatttgaactcagatgaggaaaaacacaag
gaattcgcaagacaaattgatttcaggctttctgatcaaagtggacacgaatcagagcac
tatctgaatgtaaaggaagaaggtgacaaagttattgaggaagccaaaccttctatctcc
aagagtatgaaattgttaaatgaattatcgctgatgcctggttcctatcacatgccatat
aacgagccaaatgacactcagttatatttcgctgtcgtctacctggctcccggtgattac
catcattatcactctccggtaaactgggtttgtaaacttcgtcgtcatttcccaggtgat
ctattctctgtggctccttacttccaacgtaatttccctaatctgtttgtgttaaatgaa
cgtgtcgctctgttaggtcactggaaacatggtttcttcagcatgacagcagttggtgcc
acaaatgtggggtctatcaagttgagttttgacaaggaactggtaactaacgttagaaga
aaaaagcataacgagcctcattcctgctacgaagctacctatcaaaacgctagcaagata
cttggcggtatgccactgattaagggtgaagagatgggtggttttatgctgggtagtact
gttgtgttgtgcttcgaagcaccaagagggttccagttcgacgtcaaagtgggtgacaag
gtcaaattgggtcaagcgttgggagctgtagagtag

DBGET integrated database retrieval system