KEGG   Torulaspora delbrueckii: TDEL_0F04290Help
Entry
TDEL_0F04290      CDS       T02236                                 

Gene name
TDEL0F04290
Definition
(RefSeq) hypothetical protein
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl04011  MAPK signaling pathway - yeast
tdl04139  Mitophagy - yeast
tdl04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    TDEL_0F04290 (TDEL0F04290)
 09140 Cellular Processes
  09141 Transport and catabolism
   04139 Mitophagy - yeast
    TDEL_0F04290 (TDEL0F04290)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    TDEL_0F04290 (TDEL0F04290)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tdl01001]
    TDEL_0F04290 (TDEL0F04290)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TDEL_0F04290 (TDEL0F04290)
Protein kinases [BR:tdl01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   TDEL_0F04290 (TDEL0F04290)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo APH FTA2 RIO1 Kinase-like
Motif
Other DBs
NCBI-GeneID: 11501835
NCBI-ProteinID: XP_003682451
UniProt: G8ZX96
Position
6:801456..802739
Genome map
AA seq 427 aa AA seqDB search
MATHEEFIRTQVFGTVFEITNRYTDLNPVGMGAFGLVCSATDTLAQQPVAIKKIMKPFST
AVLAKRTYRELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQF
VQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYDVEVDIWSAGCIFAEMTEGKPLFPGKDHVHQFSIITDLLGSPPEDV
INTICSENTLKFVTSLPHRDPVPFRERFKTVEPEAVDLLEKMLVFDPKKRITAADALVHP
YLAPYHDPTDEPVADAKFDWNFNDADLPVDTWRVMMYSEILDFHKIGGGDGQIDTSATFD
DQVAAATAAAAHAAAVAQAQAQAHSNSSNSNSLSNVNSKSKAARDSANDAITNYGNQAVH
YANEFQQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcatgaagagtttattaggactcaagtgttcggtacggtcttcgagatcaca
aaccgttacacagatctcaatcctgtaggtatgggggcgttcgggctcgtttgctccgct
actgatactttggctcaacaacccgttgcgattaaaaaaattatgaaacctttctcgact
gctgtcttggccaagaggacgtaccgtgaattgaaattgctgaaacatttgagacatgaa
aatctaatttgtctacaggatatcttcttatctccgctggaagatatctatttcgttact
gagttgcaagggactgatttacaccgtcttttgcagactcgtcccctggaaaaacagttt
gttcagtattttctttaccagatcctaagaggtctgaaatatgtgcattcagccggtgtg
attcatagggatttgaaacctagtaacattttgataaacgagaattgtgatttgaagatt
tgcgattttggattggcaaggattcaggatccgcagatgacgggttatgtttctactcgt
tactatagggctccggagattatgttgacatggcaaaaatacgacgtggaagttgatatt
tggtctgctggttgtatctttgcggagatgacagaggggaagcctttgttccctggtaag
gatcatgttcatcagttttctatcattacggatctgttgggttcgccaccggaagatgtt
atcaatacgatatgttctgaaaatacgctgaaatttgtgacttctttgccccatcgtgat
cccgtgccttttagagagagattcaagaccgtagagcccgaagccgttgatctgttggag
aaaatgctggtgttcgatccaaagaagagaatcaccgccgctgatgcactggtgcatccg
tatttggcgccatatcacgatcctactgacgaaccggtagcagatgcgaaattcgattgg
aatttcaatgacgctgacctaccggttgatacttggcgtgtgatgatgtactctgagatt
ttggatttccacaagatcggtgggggcgatggtcaaatcgatacttcggctacttttgac
gaccaggtggcagctgcaactgcagctgctgcacatgctgctgctgtggctcaggctcag
gctcaggctcattcaaactcttcaaattcaaattcattgtcaaatgtaaattcaaaatca
aaggcggctagggattccgctaatgatgcaatcactaattatggtaaccaagcggttcac
tatgcaaatgagttccaacagtaa

DBGET integrated database retrieval system