KEGG   Torulaspora delbrueckii: TDEL_0G04760Help
Entry
TDEL_0G04760      CDS       T02236                                 

Gene name
TDEL0G04760
Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00052  Galactose metabolism
tdl00500  Starch and sucrose metabolism
tdl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    TDEL_0G04760 (TDEL0G04760)
   00500 Starch and sucrose metabolism
    TDEL_0G04760 (TDEL0G04760)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     TDEL_0G04760 (TDEL0G04760)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Pec_lyase_N
Motif
Other DBs
NCBI-GeneID: 11505295
NCBI-ProteinID: XP_003683054
UniProt: G8ZY76
Position
7:complement(868891..870468)
Genome map
AA seq 525 aa AA seqDB search
MNDPNGLWYDAKEELYHMYFQYNPEDNIWGSPLYWGHAVSDDLTTWEERGIALGPKTNDS
AAFSGSAVVDVDNTSGFFNDTTDPRQRVVAIWTHNAPDKQSQYVSYSVDGGDTFIEYENN
PVLDLNSTQFRDPKVIWHEETKKWIMIVAMSQKYEIAIYSSDDLVDWTYESAFGNAGYLG
FQYECPGLVKVPVVQTEQGGLTVSNLTYPNTTSYNSTYFNATNTSTVNNEAWVMFLSIYP
GGPLGGSATQYFIGDFNGTHFEPFTTQARFLDLGKDYYAVQTFYNSPNADEVLGIAWASN
WQYAQNVPTYEWRSSMSLARNFTLREYSPNPESVQLNLNSEPVLNANPVEAQNATFSFED
ELLLIDNELSGNFPSNISATAIEFEIEWSVNEIAFNITELNGFVLSLATDDYDEFLTFGY
EANAQSFFFNRGNTEEPFVYANPFFNEKLSVYLEPYSTSSNGTNTYKVHGIVDQNIAELY
FNDGSVVSTNLFFTTPGNQLTWWSVDTSIDGGFKLDNFTISVLDV
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatccaaatgggttgtggtacgatgcgaaggaggaactttaccacatgtacttc
cagtacaacccagaagacaatatttggggttcaccattgtattggggtcatgcagtctct
gatgatttgactacttgggaagaaagaggtattgccttaggaccaaaaaccaatgactcg
gcggcattctctggtagtgctgtggttgatgtcgacaacacttctggatttttcaatgat
actactgacccaagacaaagagttgtggcaatctggactcataacgcacctgacaagcaa
tcccaatacgttagttactctgttgatggtggtgacactttcatcgagtatgagaacaac
cctgtgctagatctgaactcaactcagtttagagatcctaaggttatctggcacgaggag
actaagaaatggattatgattgttgctatgtctcaaaaatacgagattgcaatttattct
tccgatgacttggttgattggacatatgaatctgcctttggtaatgcagggtatttggga
ttccaatatgagtgtcccgggttggttaaggttccagtcgtccaaacggaacaaggtggt
ttgactgtctccaacttgacttatccaaacaccacttcttacaacagcacttatttcaat
gccacaaacacatcgactgtgaacaacgaagcttgggttatgttcttgtctatctatcct
ggtggcccactaggtggttctgctactcagtatttcattggtgatttcaatggtacccac
ttcgagccatttacgacccaagctagattcttggatctaggtaaggactattacgccgtc
caaaccttctacaattctccaaacgctgatgaagttttgggtatcgcatgggcttctaac
tggcaatatgctcaaaatgttcctacctatgagtggagatcttcgatgtctttggccaga
aacttcaccttgagagaatattcgccaaaccctgagtcggtccaattgaacttgaatagt
gagccggtcttgaacgccaacccagtggaggcccaaaatgccaccttttccttcgaggat
gaacttctgttgattgacaatgaattgtcgggaaatttccctagcaacatcagtgctaca
gccatcgaatttgaaatagagtggtctgttaacgaaatcgcattcaacattaccgaattg
aatggatttgttttaagtttggccaccgatgattacgatgagttcttgacttttggctac
gaagctaatgcgcaatcattcttcttcaatagaggtaacactgaggagcctttcgtctac
gctaacccatttttcaacgaaaaactatctgtctatttggagccatactcgacttcaagc
aacggtaccaacacttacaaggttcatggtattgttgatcaaaatattgcagaattgtat
ttcaatgatggttcagttgttagcaccaatctatttttcactaccccaggaaaccaacta
acctggtggtccgtcgatactagtatcgatggtggattcaaactcgacaacttcacgatc
agcgtcttggacgtttga

DBGET integrated database retrieval system