KEGG   Torulaspora delbrueckii: TDEL_0H04460Help
Entry
TDEL_0H04460      CDS       T02236                                 

Gene name
TDEL0H04460
Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TDEL_0H04460 (TDEL0H04460)
Enzymes [BR:tdl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     TDEL_0H04460 (TDEL0H04460)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     TDEL_0H04460 (TDEL0H04460)
    1.1.1.-  
     TDEL_0H04460 (TDEL0H04460)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 11501706
NCBI-ProteinID: XP_003683516
UniProt: G9A0B1
Position
8:complement(769988..771136)
Genome map
AA seq 382 aa AA seqDB search
MRALAYFKKGDIHFADDLPEPTINSDEEVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSH
PLSGKKLPQPMGHEMSGIVSKIGSKVTKVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTC
SACEKGLVNICAHACFTGLGTSGGGFAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWH
AAKVAGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVFNP
AEHKDAIAELRKIPEGATGFDAAFDCSGVKATFNTALHVTTFRGVSVNIAIWGNKPIDYY
PMDITLQEKRLTGSIGYTVQDFKEVVEAIHTGEIPIDDCRQMITGKQKLEDGWEKGFVEL
MNHKETNVKILLTPNNHNELST
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagagctttagcttactttaagaagggcgatatccacttcgcggatgatctaccggaa
ccaacaattaatagcgatgaggaagtcttaatcgaggtctcatgggcaggtatctgtgga
actgacctacatgagtactctgatggaccaatctttatgccgcaagatggcggatcgcat
ccgttatcaggtaagaaattacctcaacccatgggacacgagatgtccggtatcgtatcg
aagattggttccaaggtcaccaaggtgaaagttggtgatcatgttgtcgttgaagccggc
tgttcttgcatggacgtcaagcgttggaaggaatcccctctcaaaggtggtaagacttgt
tccgcatgtgaaaaaggtttggtgaacatctgtgcacacgcttgtttcactggtcttggt
actagtggtggtggtttcgccgaaagattgactgtctctcaagaccactgtattcctatt
ccaaaggatctaccattggatgttgctgccttggtggaacctttgtcagtcacttggcat
gccgctaaggtcgctggtttccaaaaaggtcaaaccgcatgtgttcttggtgctggtcca
attggtctagccaccatcctaactctcaagggcctcggtgcaagcaagattgttgtttcc
gaattggcccagatcagaagagatatggccgcctcaatgggtgttgaagtcttcaaccct
gctgaacacaaggatgctattgctgaacttcgtaagatcccagaaggagccactggtttc
gacgcagcttttgattgttccggtgtgaaagccactttcaacactgctcttcatgtcact
actttcagaggtgtttctgttaacatcgccatttgggggaacaaaccaattgattattac
ccaatggatatcactttgcaagagaagagattgactgggtctatcggttacacagtgcaa
gatttcaaagaagtcgtcgaagcaattcataccggtgagattccaattgatgattgtaga
caaatgattaccggtaagcagaaattggaagatggttgggagaaaggttttgtagaattg
atgaaccataaggagactaatgtcaagatcctgctgactccaaacaaccacaatgagctt
agcacctaa

DBGET integrated database retrieval system