KEGG   Sulfurimonas denitrificans: Suden_0099Help
Entry
Suden_0099        CDS       T00298                                 

Definition
(GenBank) Pyruvate:acceptor oxidoreductase beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00010  Glycolysis / Gluconeogenesis
tdn00020  Citrate cycle (TCA cycle)
tdn00620  Pyruvate metabolism
tdn00633  Nitrotoluene degradation
tdn00640  Propanoate metabolism
tdn00650  Butanoate metabolism
tdn00680  Methane metabolism
tdn00720  Carbon fixation pathways in prokaryotes
tdn01100  Metabolic pathways
tdn01120  Microbial metabolism in diverse environments
tdn01130  Biosynthesis of antibiotics
tdn01200  Carbon metabolism
Module
tdn_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
tdn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Suden_0099
   00020 Citrate cycle (TCA cycle)
    Suden_0099
   00620 Pyruvate metabolism
    Suden_0099
   00640 Propanoate metabolism
    Suden_0099
   00650 Butanoate metabolism
    Suden_0099
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Suden_0099
   00680 Methane metabolism
    Suden_0099
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Suden_0099
Enzymes [BR:tdn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Suden_0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ABB43380
UniProt: Q30UF1
Position
104730..105686
Genome map
AA seq 318 aa AA seqDB search
MSEMKNIKNLKEFSTSADRFEGANLLCPGCAHSIIVREVLNATNDDLVLSASTGCLEVCT
AVYPYTSWDASWIHIGFENSSTAVAGAETMYKALKKKGRLKQPERNPKFVSFAGDGASYD
IGFQWISGCMERGHNMMHVVLDNEVYANTGGQRSSSTPIGSSATTSPAGRVSYGEKRNKK
DMMSIMAAHGIPYAAQVAPNKWKDMVKKIQHGLSVEGPVFINAVSPCTTEWKFDPKDTMH
ITDLATDSLVFPLYEIIDGTELNITYRPKNVVPVEEYLAAQGRFKHLFKDEYKYLIKEWQ
ERVDAKWAYLQRREESRV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatgaaaaatataaaaaacttaaaagagttttcaacatcagctgaccgtttt
gagggagccaaccttttatgtccaggttgtgcacactctattattgttcgtgaagtttta
aatgctacaaatgatgacttagttctatctgcatcaacaggatgtctagaggtttgtaca
gcagtttatccatatacttcttgggatgcttcttggattcatattggatttgagaatagt
tcaactgcagttgctggtgctgagacaatgtataaagcactaaagaaaaaagggcgccta
aagcaaccagaacgtaatcctaagtttgtatcttttgcaggtgatggcgcatcttatgat
atcggttttcagtggatttctggatgtatggagcgtggacacaatatgatgcatgtcgtt
cttgataatgaagtttacgcaaatactggaggacaaagatcatcttcaactccaattggc
tcaagtgctactacatctccagctggtcgtgttagttatggggagaaaagaaacaaaaaa
gatatgatgtcaattatggcagctcatggcataccatatgctgcgcaagtagctccaaac
aagtggaaagatatggttaagaagattcaacatggtctctcagtagagggtcctgtattt
attaatgcagtttctccatgtacaacagagtggaaatttgatccaaaagatacaatgcac
attacagatttagcaacagattctttagtgtttcctctttatgagattattgacggaaca
gagttaaatattacatatagacctaaaaatgttgttcctgtagaggagtatttagctgct
caagggcgttttaaacaccttttcaaagatgagtacaaatacttaataaaagagtggcaa
gagcgcgtagatgctaaatgggcatatttacaacgccgtgaagagtcacgcgtataa

DBGET integrated database retrieval system